ZRdb KZFP & Repeats
...

Human_ZNF98

  • Protein
    Zinc finger protein 98
  • Length
    572
  • Organism
    Homo sapiens (Human)
  • Time of emergence
    19.6 Mya
  • Time of Changing in binding specificity
    19.6 Mya
  • Uniprot_ID
    A6NK75
  • NCBI_ID
    148198
Sequence:
MPGPLGSLEMGVLTFRDVALEFSLEEWQCLDTAQQNLYRNVMLENYRNLVFVGIAASKPDLITCLEQGKEPWNVKRHEMVTEPPVVYSYFAQDLWPKQGKKNYFQKVILRTYKKCGRENLQLRKYCKSMDECKVHKECYNGLNQCLTTTQNKIFQYDKYVKVFHKFSNSNRHKIGHTGKKSFKCKECEKSFCMLSHLAQHKRIHSGEKPYKCKECGKAYNEASNLSTHKRIHTGKKPYKCEECGKAFNRLSHLTTHKIIHTGKKPYKCEECGKAFNQSANLTTHKRIHTGEKPYKCEECGRAFSQSSTLTAHKIIHAGEKPYKCEECGKAFSQSSTLTTHKIIHTGEKFYKCEECGKAFSRLSHLTTHKRIHSGEKPYKCEECGKAFKQSSTLTTHKRIHAGEKFYKCEVCSKAFSRFSHLTTHKRIHTGEKPYKCEECGKAFNLSSQLTTHKIIHTGEKPYKCEECGKAFNQSSTLSKHKVIHTGEKPYKCEECGKAFNQSSHLTTHKMIHTGEKPYKCEECGKAFNNSSILNRHKMIHTGEKLYKPESCNNACDNIAKISKYKRNCAGEK
Domain KRAB, ZF, and degenerated ZF domains of KZFPs. :
...
# Domain name Pos
1 KRAB 13..84
2 C2h2 182..204
3 C2h2 210..232
4 C2h2 238..260
5 C2h2 266..288
6 C2h2 294..316
7 C2h2 322..344
8 C2h2 350..372
9 C2h2 378..400
10 C2h2 406..428
11 C2h2 434..456
12 C2h2 462..484
13 C2h2 490..512
14 C2h2 518..540
Gene Ontology Annotation The Gene Ontology (GO) describes knowledge of the biological domain based on three aspects: Molecular function, Biological process, and Cellular component. :
# Type TERM
1 Cellular Component nucleus
2 Molecular Function DNA-binding transcription factor activity, RNA polymerase II-specific
3 Molecular Function metal ion binding
4 Molecular Function RNA polymerase II cis-regulatory region sequence-specific DNA binding
5 Biological Process regulation of DNA-templated transcription
Is there ChIP-seq data Is there any ChIP-seq data available for these KZFPs in the Cistrome database? :
No
Motif(Predicted) DNA binding motifs predicted using Zinc Finger Recognition Code. :
Forward:
...
No Chip-seq
No Chip-seq
No Chip-seq