ZRdb KZFP & Repeats
...

Human_ZNF90

  • Protein
    Zinc finger protein 90
  • Length
    601
  • Organism
    Homo sapiens (Human)
  • Time of emergence
    74.0 Mya
  • Time of Changing in binding specificity
    8.6 Mya
  • Uniprot_ID
    Q03938
  • NCBI_ID
    7643
Sequence:
MGPLEFRDVAIEFSLEEWHCLDTAQQNLYRDVMLENYRHLVFLGIVVTKPDLITCLEQGKKPFTVKRHEMIAKSPVMCFHFAQDLCPEQSLKDSFQKVIVTRYEKREYGNLELKKGCESVDEGKVHKRGYNGLNQCLTATQSKVFQCDTYVKVSHIFSNSNRHKIRDTGKKPFKCIECGKAFNQSSTLATHKKIHTGEITCKCEECGKAFNRSSHLTSHKRIHTGEKRYKCEDCGKELKYSSTLTAHKRIHTGEKRYKCEDCGKELKYSSTLTAHKRIHTGEKPYKCDKCGRAFISSSILYVHKISHTEEKPYKCEECGKAFKLSSILSTHKRIHTGEKPYKCEECGKAFRRSLVLRTHKRIHTGEKPYKCDKCGKAFISSSLLYKHKISHSEKKPYKCEECGKAFKRSSTLTIHKISHTEEKPYKCQECDKVFKRSSALSTHKIIHSGEKPYKCEECGKAFKRSSNLTTHKISHTEEKLYKCQECDKAFKYSSALSTHKIIHSGENPYKCEECGKAFKRSSVLSKHKIIHTGAKPYKCEECGKAFKRSSQLTSHKISHTGEKPYKCEECGKAFNLSSDLNTHKRIHIGQKAYIVKNMANL
Domain KRAB, ZF, and degenerated ZF domains of KZFPs. :
...
# Domain name Pos
1 KRAB 4..75
2 C2h2 173..195
3 C2h2 201..223
4 C2h2 229..251
5 C2h2 257..279
6 C2h2 285..307
7 C2h2 313..335
8 C2h2 341..363
9 C2h2 369..391
10 C2h2 397..419
11 C2h2 425..447
12 C2h2 453..475
13 C2h2 481..503
14 C2h2 509..531
15 C2h2 537..559
16 C2h2 565..587
Gene Ontology Annotation The Gene Ontology (GO) describes knowledge of the biological domain based on three aspects: Molecular function, Biological process, and Cellular component. :
# Type TERM
1 Cellular Component nucleus
2 Molecular Function DNA-binding transcription factor activity
3 Molecular Function DNA-binding transcription factor activity, RNA polymerase II-specific
4 Molecular Function RNA polymerase II cis-regulatory region sequence-specific DNA binding
5 Molecular Function zinc ion binding
6 Biological Process regulation of DNA-templated transcription
Is there ChIP-seq data Is there any ChIP-seq data available for these KZFPs in the Cistrome database? :
Yes
Motif(meme-ChIP) DNA binding motifs of KZFPs obtained using meme-ChIP and mapped using pylogo. :
Forward:
...
Reverse:
...
Peak overlapping A ChIP-seq peak of KZFPs that intersects with a certain repeats sequences on the genome. :
# Repeats name Record number Significance Emergence time(Mya) Time correlation with KZFP
1 HERVH-int 132 **** 28.9 Weakly correlated
2 LTR10A 4 **** 28.9 Weakly correlated
3 LTR10F 3 **** 28.9 Weakly correlated
4 L1PA2 2 n.s 15.2 Moderately correlated
5 AluSc8 1 n.s 74.0 Weakly correlated
6 AluY 1 n.s 74.0 Weakly correlated
7 AluYj4 1 ** 0.0 Weakly correlated
8 AluYm1 1 * 19.6 Moderately correlated
9 L1MA4A 1 n.s 87.0 Weakly correlated
10 L1PA5 1 n.s 19.6 Moderately correlated
11 LTR12C 1 n.s 19.6 Moderately correlated
12 LTR13 1 ** 19.6 Moderately correlated
13 MER50 1 ** 43.0 Weakly correlated
14 MLT1L 1 * 99.0 Weakly correlated
15 SVA_C 1 ** 15.2 Moderately correlated
Motif in Repeats The motif of KZFPs identified by the MEME-ChIP is present in repeats sequences. :
# Repeats name Record number Significance Emergence time(Mya) Time correlation with KZFP
1 HERVH-int 132 **** 28.9 Weakly correlated
Motif in Repeats Consensus The motif of KZFPs identified by MEME-ChIP analysis can be utilized to locate the corresponding region within the consensus sequences of repeats. :
# Repeats name Emergence time(Mya) Time correlation with KZFP
1 HERVH-INT 28.9 Weakly correlated