ZRdb KZFP & Repeats
...

Human_ZNF880

  • Protein
    Zinc finger protein 880
  • Length
    577
  • Organism
    Homo sapiens (Human)
  • Time of emergence
    43.0 Mya
  • Time of Changing in binding specificity
    28.9 Mya
  • Uniprot_ID
    Q6PDB4
  • NCBI_ID
    400713
Sequence:
MLRRGHLAFRDVAIEFPQEEWKCLDPAQRTLYREVMVENYRNLVFLGICLPDLSVISMLEQRRDPRNLQSEVKIANNPGGRECIKGVNAESSSKLGSNAGNKSLKNQLGLTFQLHLSELQLFQAERNISGCKHVEKPINNSLVSPLQKIYSSVKSHILNKYRNDFDDSPFLPQEQKAQIREKPCECNEHGKAFRVSSRLANNQVIHTADNPYKCNECDKVFSNSSNLVQHQRIHTGEKPYKCHECGKLFNRISLLARHQRIHTGEKPYKCHECGKVFTQNSHLANHHRIHTGEKPYKCNECGKVFNRNAHLARHQKIHSGEKPYKCKECGKAFSGGSGLTAHLVIHTGEKLYKCNKCGKVFNRNAHLTRHQRIHTGEKPYECKECGKVFRHKFCLTNHHRMHTGEQPYKCNECGKAFRDCSGLTAHLLIHTGEKPYKCKECAKVFRHRLSLSNHQRFHTGEKPYRCDECGKDFTRNSNLANHHRIHTGEKPYKCSECHKVFSHNSHLARHRQIHTGEKSYKCNECGKVFSHKLYLKKHERIHTGEKPYRCHECGKDFTRNSNLANHHRIHTGEKPYR
Domain KRAB, ZF, and degenerated ZF domains of KZFPs. :
...
# Domain name Pos
1 KRAB 7..78
2 dec2h2 184..206
3 C2h2 212..234
4 C2h2 240..262
5 C2h2 268..290
6 C2h2 296..318
7 C2h2 324..346
8 C2h2 352..374
9 C2h2 380..402
10 C2h2 408..430
11 C2h2 436..458
12 C2h2 464..486
13 C2h2 492..514
14 C2h2 520..542
15 C2h2 548..570
Gene Ontology Annotation The Gene Ontology (GO) describes knowledge of the biological domain based on three aspects: Molecular function, Biological process, and Cellular component. :
# Type TERM
1 Cellular Component nucleus
2 Molecular Function DNA-binding transcription factor activity, RNA polymerase II-specific
3 Molecular Function metal ion binding
4 Molecular Function RNA polymerase II cis-regulatory region sequence-specific DNA binding
5 Biological Process regulation of transcription by RNA polymerase II
Is there ChIP-seq data Is there any ChIP-seq data available for these KZFPs in the Cistrome database? :
Yes
Motif(meme-ChIP) DNA binding motifs of KZFPs obtained using meme-ChIP and mapped using pylogo. :
Forward:
...
Reverse:
...
Peak overlapping A ChIP-seq peak of KZFPs that intersects with a certain repeats sequences on the genome. :
# Repeats name Record number Significance Emergence time(Mya) Time correlation with KZFP
1 L1M1 25 **** 74.0 Weakly correlated
2 L2c 8 * 99.0 Weakly correlated
3 L1P3 5 **** 74.0 Weakly correlated
4 L1MA3 5 ** 74.0 Weakly correlated
5 L1MA2 5 *** 74.0 Weakly correlated
6 L1PA5 4 n.s 19.6 Weakly correlated
7 AluJb 3 n.s 74.0 Weakly correlated
8 LTR10A 3 **** 28.9 Highly correlated
9 AluSz 3 n.s 74.0 Weakly correlated
10 AluSc 2 n.s 74.0 Weakly correlated
11 LTR10F 2 **** 28.9 Highly correlated
12 L2b 2 n.s 99.0 Weakly correlated
13 L1PA2 2 n.s 15.2 Weakly correlated
14 L1P4 2 ** 74.0 Weakly correlated
15 HERVK3-int 2 **** 28.9 Highly correlated
16 AluSq2 1 n.s 74.0 Weakly correlated
17 X7B_LINE 1 *** 319.0 Weakly correlated
18 THE1B 1 n.s 43.0 Moderately correlated
19 MSTD 1 * 74.0 Weakly correlated
20 MLT1C 1 n.s 94.0 Weakly correlated
21 MIRb 1 n.s 99.0 Weakly correlated
22 MIR 1 n.s 99.0 Weakly correlated
23 MER50 1 * 43.0 Moderately correlated
24 MER41E 1 *** 74.0 Weakly correlated
25 MER39B 1 ** 74.0 Weakly correlated
26 LTR13 1 ** 19.6 Weakly correlated
27 AluSc5 1 * 74.0 Weakly correlated
28 AluSc8 1 n.s 74.0 Weakly correlated
29 AluSp 1 n.s 74.0 Weakly correlated
30 FLAM_C 1 n.s 74.0 Weakly correlated
31 L2a 1 n.s 99.0 Weakly correlated
32 L2 1 n.s 99.0 Weakly correlated
33 AluSx 1 n.s 74.0 Weakly correlated
34 L1PA4 1 n.s 19.6 Weakly correlated
35 AluSx1 1 n.s 74.0 Weakly correlated
36 AluSx3 1 n.s 74.0 Weakly correlated
37 AluSz6 1 n.s 74.0 Weakly correlated
38 L1P1 1 n.s 19.6 Weakly correlated
39 L1MA9 1 n.s 99.0 Weakly correlated
40 AluY 1 n.s 74.0 Weakly correlated
41 AluYh9 1 **** 15.2 Weakly correlated
42 AluYm1 1 * 19.6 Weakly correlated
Motif in Repeats The motif of KZFPs identified by the MEME-ChIP is present in repeats sequences. :
# Repeats name Record number Significance Emergence time(Mya) Time correlation with KZFP
1 L1M1 6 *** 74.0 Weakly correlated
2 L1MA3 4 ** 74.0 Weakly correlated
3 AluSz 2 n.s 74.0 Weakly correlated
4 AluSc 1 n.s 74.0 Weakly correlated
5 L2b 1 n.s 99.0 Weakly correlated
6 AluSx1 1 n.s 74.0 Weakly correlated
7 AluSz6 1 n.s 74.0 Weakly correlated
8 AluSp 1 n.s 74.0 Weakly correlated
9 AluSx 1 n.s 74.0 Weakly correlated
10 AluYh9 1 **** 15.2 Weakly correlated
11 AluSx3 1 n.s 74.0 Weakly correlated
Motif in Repeats Consensus The motif of KZFPs identified by MEME-ChIP analysis can be utilized to locate the corresponding region within the consensus sequences of repeats. :
# Repeats name Emergence time(Mya) Time correlation with KZFP
1 L1M1 74.0 Weakly correlated