ZRdb KZFP & Repeats
...

Human_ZNF829

  • Protein
    Zinc finger protein 829
  • Length
    432
  • Organism
    Homo sapiens (Human)
  • Time of emergence
    99.0 Mya
  • Time of Changing in binding specificity
    99.0 Mya
  • Uniprot_ID
    Q3KNS6
  • NCBI_ID
    374899
Sequence:
MPHSPLISIPHVWCHPEEEERMHDELLQAVSKGPVMFRDVSIDFSQEEWECLDADQMNLYKEVMLENFSNLVSVGLSNSKPAVISLLEQGKEPWMVDRELTRGLCSDLESMCETKILSLKKRHFSQVIITREDMSTFIQPTFLIPPQKTMSEEKPWECKICGKTFNQNSQFIQHQRIHFGEKHYESKEYGKSFSRGSLVTRHQRIHTGKKPYECKECGKAFSCSSYFSQHQRIHTGEKPYECKECGKAFKYCSNLNDHQRIHTGEKPYECKVCGKAFTKSSQLFLHLRIHTGEKPYECKECGKAFTQHSRLIQHQRMHTGEKPYECKQCGKAFNSASTLTNHHRIHAGEKLYECEECRKAFIQSSELIQHQRIHTDEKPYECNECGKAFNKGSNLTRHQRIHTGEKPYDCKECGKAFGSRSDLIRHEGIHTG
Domain KRAB, ZF, and degenerated ZF domains of KZFPs. :
...
# Domain name Pos
1 KRAB 35..106
2 C2h2 156..178
3 dec2h2 184..206
4 C2h2 212..234
5 C2h2 240..262
6 C2h2 268..290
7 C2h2 296..318
8 C2h2 324..346
9 C2h2 352..374
10 C2h2 380..402
11 C2h2 408..430
Gene Ontology Annotation The Gene Ontology (GO) describes knowledge of the biological domain based on three aspects: Molecular function, Biological process, and Cellular component. :
# Type TERM
1 Cellular Component nucleus
2 Molecular Function DNA-binding transcription factor activity, RNA polymerase II-specific
3 Molecular Function metal ion binding
4 Molecular Function RNA polymerase II cis-regulatory region sequence-specific DNA binding
5 Biological Process regulation of transcription by RNA polymerase II
Is there ChIP-seq data Is there any ChIP-seq data available for these KZFPs in the Cistrome database? :
Yes
Motif(meme-ChIP) DNA binding motifs of KZFPs obtained using meme-ChIP and mapped using pylogo. :
Forward:
...
Reverse:
...
Peak overlapping A ChIP-seq peak of KZFPs that intersects with a certain repeats sequences on the genome. :
# Repeats name Record number Significance Emergence time(Mya) Time correlation with KZFP
1 LTR10A 4 **** 28.9 Weakly correlated
2 L2c 4 n.s 99.0 Highly correlated
3 L1PA2 3 n.s 15.2 Weakly correlated
4 MER21B 2 ** 99.0 Highly correlated
5 L1PA5 2 n.s 19.6 Weakly correlated
6 L1PA4 2 n.s 19.6 Weakly correlated
7 L1PA10 2 n.s 74.0 Weakly correlated
8 L1HS 2 n.s 8.6 Weakly correlated
9 FRAM 2 ** 74.0 Weakly correlated
10 AluYj4 2 ** 0.0 Weakly correlated
11 AluY 2 n.s 74.0 Weakly correlated
12 MIRb 1 n.s 99.0 Highly correlated
13 SVA_E 1 ** 0.0 Weakly correlated
14 LTR12C 1 n.s 19.6 Weakly correlated
15 MLT1L 1 n.s 99.0 Highly correlated
16 SVA_D 1 n.s 15.2 Weakly correlated
17 LTR10B1 1 *** 28.9 Weakly correlated
18 AluSc8 1 n.s 74.0 Weakly correlated
19 L2b 1 n.s 99.0 Highly correlated
20 L1MD 1 n.s 99.0 Highly correlated
21 L1MC4 1 n.s 99.0 Highly correlated
22 L1MB8 1 n.s 99.0 Highly correlated
23 HERV17-int 1 * 28.9 Weakly correlated
24 AluYk3 1 ** 19.6 Weakly correlated
25 AluSx3 1 n.s 74.0 Weakly correlated
Motif in Repeats The motif of KZFPs identified by the MEME-ChIP is present in repeats sequences. :
# Repeats name Record number Significance Emergence time(Mya) Time correlation with KZFP
1 AluY 1 n.s 74.0 Weakly correlated
2 L1PA10 1 n.s 74.0 Weakly correlated
Motif in Repeats Consensus The motif of KZFPs identified by MEME-ChIP analysis can be utilized to locate the corresponding region within the consensus sequences of repeats. :
# Repeats name Emergence time(Mya) Time correlation with KZFP