ZRdb KZFP & Repeats
...

Human_ZNF790

  • Protein
    Zinc finger protein 790
  • Length
    636
  • Organism
    Homo sapiens (Human)
  • Time of emergence
    99.0 Mya
  • Time of Changing in binding specificity
    99.0 Mya
  • Uniprot_ID
    Q6PG37
  • NCBI_ID
    388536
Sequence:
MAHLMMFRDVAVDFSQEEWECLDLEQRDLYRDVMLENYSNMVSLGFCIYQPEAFSLLEKGKEPWKILRDETRGPCPDMQSRCQTKKLLPKNGIFEREIAQLEIMRICKNHSLDCLCFRGDWEGNTQFQTLQDNQEECFKQVIRTCEKRPTFNQHTVFNLHQRLNTGDKLNEFKELGKAFISGSDHTQHQLIHTSEKFCGDKECGNTFLPDSEVIQYQTVHTVKKTYECKECGKSFSLRSSLTGHKRIHTGEKPFKCKDCGKAFRFHSQLSVHKRIHTGEKSYECKECGKAFSCGSDLTRHQRIHTGEKPYECNECRKAFSQRSHLIKHQRIHTGEKPYECKECGKAFTRGSHLTQHQRIHTGEKSHECKECGKAFIRGSNLAQHQNVHVGRKPYKCEKCGKAYIWSSHLARHQRIHTGRKPYECKQCGKTFTWASYLAQHEKIHNERKSYECKECGKTFLHGSEFNRHQKIHTGERNYECKECGKTFFRGSELNRHQKIHTGKRPYECEECGKAFLWGSQLTRHQRMHTGEEPYVCKECGKSFIWGSQLTRHKKIHTDAEPYGCKKSSHIFSHHSYFTEQKIHNSANLCEWTDYGNTFSHESNFAQHQNIYTFEKSYEFKDFEKAFSSSSHFISLL
Domain KRAB, ZF, and degenerated ZF domains of KZFPs. :
...
# Domain name Pos
1 KRAB 5..76
2 dec2h2 196..220
3 C2h2 226..248
4 C2h2 254..276
5 C2h2 282..304
6 C2h2 310..332
7 C2h2 338..360
8 C2h2 366..388
9 C2h2 394..416
10 C2h2 422..444
11 C2h2 450..472
12 C2h2 478..500
13 C2h2 506..528
14 C2h2 534..556
Gene Ontology Annotation The Gene Ontology (GO) describes knowledge of the biological domain based on three aspects: Molecular function, Biological process, and Cellular component. :
# Type TERM
1 Cellular Component nucleus
2 Molecular Function DNA-binding transcription factor activity, RNA polymerase II-specific
3 Molecular Function metal ion binding
4 Molecular Function RNA polymerase II cis-regulatory region sequence-specific DNA binding
5 Biological Process regulation of transcription by RNA polymerase II
Is there ChIP-seq data Is there any ChIP-seq data available for these KZFPs in the Cistrome database? :
Yes
Motif(meme-ChIP) DNA binding motifs of KZFPs obtained using meme-ChIP and mapped using pylogo. :
Forward:
...
Reverse:
...
Peak overlapping A ChIP-seq peak of KZFPs that intersects with a certain repeats sequences on the genome. :
# Repeats name Record number Significance Emergence time(Mya) Time correlation with KZFP
1 LTR33 18 **** 99.0 Highly correlated
2 LTR10A 3 **** 28.9 Weakly correlated
3 LTR10F 2 **** 28.9 Weakly correlated
4 L1PA5 2 n.s 19.6 Weakly correlated
5 MLT1A1 1 * 87.0 Weakly correlated
6 AluSq2 1 n.s 74.0 Weakly correlated
7 MIRc 1 n.s 99.0 Highly correlated
8 MIRb 1 n.s 99.0 Highly correlated
9 LTR41 1 *** 99.0 Highly correlated
10 LTR13 1 *** 19.6 Weakly correlated
11 L2c 1 n.s 99.0 Highly correlated
12 L2a 1 n.s 99.0 Highly correlated
13 L2 1 n.s 99.0 Highly correlated
14 L1PA3 1 n.s 19.6 Weakly correlated
15 L1PA11 1 n.s 74.0 Weakly correlated
16 L1P1 1 * 19.6 Weakly correlated
17 L1M7 1 ** 99.0 Highly correlated
18 L1M1 1 n.s 74.0 Weakly correlated
19 L1HS 1 * 8.6 Weakly correlated
20 HERVFH21-int 1 *** 28.9 Weakly correlated
21 HAL1 1 n.s 99.0 Highly correlated
22 AmnSINE1 1 *** 319.0 Weakly correlated
23 AluY 1 n.s 74.0 Weakly correlated
24 AluSz 1 n.s 74.0 Weakly correlated
Motif in Repeats The motif of KZFPs identified by the MEME-ChIP is present in repeats sequences. :
# Repeats name Record number Significance Emergence time(Mya) Time correlation with KZFP
1 LTR33 1 * 99.0 Highly correlated
Motif in Repeats Consensus The motif of KZFPs identified by MEME-ChIP analysis can be utilized to locate the corresponding region within the consensus sequences of repeats. :
# Repeats name Emergence time(Mya) Time correlation with KZFP