ZRdb KZFP & Repeats
...

Human_ZNF776

  • Protein
    Zinc finger protein 776
  • Length
    518
  • Organism
    Homo sapiens (Human)
  • Time of emergence
    94.0 Mya
  • Time of Changing in binding specificity
    43.0 Mya
  • Uniprot_ID
    Q68DI1
  • NCBI_ID
    284309
Sequence:
MAAAALRPPAQGTVTFEDVAVNFSQEEWSLLSEAQRCLYHDVMLENLTLISSLGCWYGAKDETPSKQTLSIQQESPLRTHWTGVCTKKVHLWGMCGPLLGDILHQGTQHNQKLNGFGAYEKKLDDDANHHQDQKQHIGEKSYRSNAKGTSFVKNCKFHMSHEPFIFHEVGKDFLSSLRLLQQEDIHTSGKSNFETKHGIPLQGGKTHYICGESTIPFSNKHSLVLHQRLLPREGPYVCSDSGKFTSKSNSFNNHQGVRTGKRPYQCGQCDESFWYKAHLTEHQRVHTGERPYECGECDKSFSHKHSLVDHQRVHTGERPYECDECGKSFSHKRSLVHHQRVHTGERPYQCGECGKSFNHKCNLIQHQRVHTGERPFECTACGKLFRSNSHLKEHQRVHTGERPYECKECRKSFRYKSHLTEHQRVHTGERPYECRECGKCFHQKGSLIQHQQIHSGERPHECGECGKCFHQKGSLIRHQQIHSGERPHECGECGKCFRQKGNLIKHQRVHTGERHHEC
Domain KRAB, ZF, and degenerated ZF domains of KZFPs. :
...
# Domain name Pos
1 KRAB 14..89
2 dec2h2 208..230
3 dec2h2 236..258
4 C2h2 264..286
5 C2h2 292..314
6 C2h2 320..342
7 C2h2 348..370
8 C2h2 376..398
9 C2h2 404..426
10 C2h2 432..454
11 dec2h2 460..482
12 C2h2 488..510
Gene Ontology Annotation The Gene Ontology (GO) describes knowledge of the biological domain based on three aspects: Molecular function, Biological process, and Cellular component. :
# Type TERM
1 Cellular Component nucleus
2 Molecular Function DNA-binding transcription factor activity, RNA polymerase II-specific
3 Molecular Function metal ion binding
4 Molecular Function RNA polymerase II cis-regulatory region sequence-specific DNA binding
5 Biological Process regulation of transcription by RNA polymerase II
Is there ChIP-seq data Is there any ChIP-seq data available for these KZFPs in the Cistrome database? :
Yes
Motif(meme-ChIP) DNA binding motifs of KZFPs obtained using meme-ChIP and mapped using pylogo. :
Forward:
...
Reverse:
...
Peak overlapping A ChIP-seq peak of KZFPs that intersects with a certain repeats sequences on the genome. :
# Repeats name Record number Significance Emergence time(Mya) Time correlation with KZFP
1 MSTA 152 **** 43.0 Highly correlated
2 MSTB 91 **** 43.0 Highly correlated
3 AluJb 7 n.s 74.0 Weakly correlated
4 MSTB1 6 **** 74.0 Weakly correlated
5 AluSx1 6 n.s 74.0 Weakly correlated
6 AluSx 4 n.s 74.0 Weakly correlated
7 AluSp 4 n.s 74.0 Weakly correlated
8 L1P3 4 ** 74.0 Weakly correlated
9 LTR10A 4 **** 28.9 Weakly correlated
10 LTR50 3 **** 99.0 Weakly correlated
11 AluSc8 2 n.s 74.0 Weakly correlated
12 MIR 2 n.s 99.0 Weakly correlated
13 L1P1 2 n.s 19.6 Weakly correlated
14 LTR67B 2 ** 99.0 Weakly correlated
15 L1PA5 2 n.s 19.6 Weakly correlated
16 L2c 2 n.s 99.0 Weakly correlated
17 AluJr 2 n.s 74.0 Weakly correlated
18 LTR13 2 *** 19.6 Weakly correlated
19 AluYm1 2 * 19.6 Weakly correlated
20 MSTB2 2 *** 74.0 Weakly correlated
21 AluY 2 n.s 74.0 Weakly correlated
22 AluSz6 2 n.s 74.0 Weakly correlated
23 AluSx3 2 n.s 74.0 Weakly correlated
24 AluSq2 2 n.s 74.0 Weakly correlated
25 LTR5B 1 ** 28.9 Weakly correlated
26 MLT1L 1 n.s 99.0 Weakly correlated
27 MER39B 1 ** 74.0 Weakly correlated
28 MIR3 1 n.s 99.0 Weakly correlated
29 MIRb 1 n.s 99.0 Weakly correlated
30 MLT1F1 1 * 99.0 Weakly correlated
31 MLT1J 1 n.s 99.0 Weakly correlated
32 L1PA10 1 n.s 74.0 Weakly correlated
33 MamSINE1 1 * 99.0 Weakly correlated
34 Plat_L3 1 * 99.0 Weakly correlated
35 LTR33 1 n.s 99.0 Weakly correlated
36 L3b 1 n.s 99.0 Weakly correlated
37 L1PA3 1 n.s 19.6 Weakly correlated
38 L1PA2 1 n.s 15.2 Weakly correlated
39 L1P4 1 n.s 74.0 Weakly correlated
40 L1ME4c 1 n.s 99.0 Weakly correlated
41 L1ME4b 1 n.s 99.0 Weakly correlated
42 L1ME3G 1 n.s 99.0 Weakly correlated
43 L1MC4 1 n.s 99.0 Weakly correlated
44 L1MC1 1 n.s 99.0 Weakly correlated
45 L1MA8 1 n.s 87.0 Weakly correlated
46 FRAM 1 * 74.0 Weakly correlated
47 AluYh9 1 **** 15.2 Weakly correlated
48 AluYh3 1 * 15.2 Weakly correlated
49 AluSq10 1 * 74.0 Weakly correlated
50 AluJo 1 n.s 74.0 Weakly correlated
Motif in Repeats The motif of KZFPs identified by the MEME-ChIP is present in repeats sequences. :
# Repeats name Record number Significance Emergence time(Mya) Time correlation with KZFP
1 MSTA 137 **** 43.0 Highly correlated
2 MSTB 86 **** 43.0 Highly correlated
3 MSTB1 6 **** 74.0 Weakly correlated
4 MSTB2 2 *** 74.0 Weakly correlated
5 AluSx 1 n.s 74.0 Weakly correlated
6 L1MC1 1 n.s 99.0 Weakly correlated
7 L1ME3G 1 n.s 99.0 Weakly correlated
8 MLT1J 1 n.s 99.0 Weakly correlated
9 AluSq10 1 * 74.0 Weakly correlated
10 AluYh3 1 * 15.2 Weakly correlated
11 AluSp 1 n.s 74.0 Weakly correlated
Motif in Repeats Consensus The motif of KZFPs identified by MEME-ChIP analysis can be utilized to locate the corresponding region within the consensus sequences of repeats. :
# Repeats name Emergence time(Mya) Time correlation with KZFP