ZRdb KZFP & Repeats
...

Human_ZNF772

  • Protein
    Zinc finger protein 772
  • Length
    489
  • Organism
    Homo sapiens (Human)
  • Time of emergence
    99.0 Mya
  • Time of Changing in binding specificity
    94.0 Mya
  • Uniprot_ID
    Q68DY9
  • NCBI_ID
    400720
Sequence:
MAAAEPMGPAQVPMNSEVIVDPIQGQVNFEDVFVYFSQEEWVLLDEAQRLLYRDVMLENFALMASLGHTSFMSHIVASLVMGSEPWVPDWVDMTLAVATETPGGSDPGCWHGMEDEEIPFEQSFSIGMSQIRIPKGGPSTQKAYPCGTCGLVLKDILHLAEHQETHPGQKPYMCVLCGKQFCFSANLHQHQKQHSGEKPFRSDKSRPFLLNNCAVQSMEMSFVTGEACKDFLASSSIFEHHAPHNEWKPHSNTKCEEASHCGKRHYKCSECGKTFSRKDSLVQHQRVHTGERPYECGECGKTFSRKPILAQHQRIHTGEMPYECGICGKVFNHSSNLIVHQRVHTGARPYKCSECGKAYSHKSTLVQHESIHTGERPYECSECGKYFGHKYRLIKHWSVHTGARPYECIACGKFFSQSSDLIAHQRVHNGEKPYVCSECGKAFSHKHVLVQHHRIHTGERPYKCSECGKAFRQRASLIRHWKIHTGERP
Domain KRAB, ZF, and degenerated ZF domains of KZFPs. :
...
# Domain name Pos
1 KRAB 27..98
2 C2h2 144..166
3 C2h2 172..194
4 C2h2 266..288
5 C2h2 294..316
6 C2h2 322..344
7 C2h2 350..372
8 C2h2 378..400
9 C2h2 406..428
10 C2h2 434..456
11 C2h2 462..484
Gene Ontology Annotation The Gene Ontology (GO) describes knowledge of the biological domain based on three aspects: Molecular function, Biological process, and Cellular component. :
# Type TERM
1 Cellular Component nucleus
2 Molecular Function DNA-binding transcription factor activity, RNA polymerase II-specific
3 Molecular Function metal ion binding
4 Molecular Function RNA polymerase II cis-regulatory region sequence-specific DNA binding
5 Biological Process regulation of transcription by RNA polymerase II
Is there ChIP-seq data Is there any ChIP-seq data available for these KZFPs in the Cistrome database? :
Yes
Motif(meme-ChIP) DNA binding motifs of KZFPs obtained using meme-ChIP and mapped using pylogo. :
Forward:
...
Reverse:
...
Peak overlapping A ChIP-seq peak of KZFPs that intersects with a certain repeats sequences on the genome. :
# Repeats name Record number Significance Emergence time(Mya) Time correlation with KZFP
1 AluYj4 10 **** 0.0 Weakly correlated
2 L1P3 8 **** 74.0 Weakly correlated
3 AluSc8 7 *** 74.0 Weakly correlated
4 AluJb 6 n.s 74.0 Weakly correlated
5 LTR10A 4 **** 28.9 Weakly correlated
6 AluSp 4 n.s 74.0 Weakly correlated
7 MER21B 4 **** 99.0 Moderately correlated
8 AluYm1 4 **** 19.6 Weakly correlated
9 FRAM 4 **** 74.0 Weakly correlated
10 LTR10F 3 **** 28.9 Weakly correlated
11 MLT1E3 3 **** 99.0 Moderately correlated
12 ERV3-16A3_I-int 2 n.s 99.0 Moderately correlated
13 L1MC4 2 n.s 99.0 Moderately correlated
14 MLT1E1A 2 ** 99.0 Moderately correlated
15 AluYa8 2 **** 15.2 Weakly correlated
16 AluY 2 n.s 74.0 Weakly correlated
17 L1P4 1 n.s 74.0 Weakly correlated
18 MLT1L 1 n.s 99.0 Moderately correlated
19 MLT2B4 1 n.s 99.0 Moderately correlated
20 MLT2C1 1 * 99.0 Moderately correlated
21 MLT2C2 1 ** 99.0 Moderately correlated
22 MER52A 1 n.s 74.0 Weakly correlated
23 MLT2F 1 * 99.0 Moderately correlated
24 LTR79 1 * 99.0 Moderately correlated
25 SVA_C 1 ** 15.2 Weakly correlated
26 LTR10B1 1 *** 28.9 Weakly correlated
27 THE1C-int 1 n.s 43.0 Weakly correlated
28 L2b 1 n.s 99.0 Moderately correlated
29 L2a 1 n.s 99.0 Moderately correlated
30 L1PA4 1 n.s 19.6 Weakly correlated
31 L1PA2 1 n.s 15.2 Weakly correlated
32 L1PA14 1 n.s 74.0 Weakly correlated
33 L1MB8 1 n.s 99.0 Moderately correlated
34 L1M4 1 n.s 99.0 Moderately correlated
35 L1M3 1 n.s 99.0 Moderately correlated
36 AluYi6 1 *** 15.2 Weakly correlated
37 AluYh9 1 **** 15.2 Weakly correlated
38 AluSz 1 n.s 74.0 Weakly correlated
39 AluSx1 1 n.s 74.0 Weakly correlated
40 AluSx 1 n.s 74.0 Weakly correlated
41 AluSc 1 n.s 74.0 Weakly correlated
Motif in Repeats The motif of KZFPs identified by the MEME-ChIP is present in repeats sequences. :
# Repeats name Record number Significance Emergence time(Mya) Time correlation with KZFP
1 AluYj4 5 **** 0.0 Weakly correlated
2 AluSc8 2 n.s 74.0 Weakly correlated
3 FRAM 2 ** 74.0 Weakly correlated
4 AluSc 1 n.s 74.0 Weakly correlated
5 AluYa8 1 **** 15.2 Weakly correlated
6 AluYh9 1 **** 15.2 Weakly correlated
7 AluSp 1 n.s 74.0 Weakly correlated
8 AluY 1 n.s 74.0 Weakly correlated
9 MLT2B4 1 n.s 99.0 Moderately correlated
Motif in Repeats Consensus The motif of KZFPs identified by MEME-ChIP analysis can be utilized to locate the corresponding region within the consensus sequences of repeats. :
# Repeats name Emergence time(Mya) Time correlation with KZFP