ZRdb KZFP & Repeats
...

Human_ZNF77

  • Protein
    Zinc finger protein 77
  • Length
    545
  • Organism
    Homo sapiens (Human)
  • Time of emergence
    94.0 Mya
  • Time of Changing in binding specificity
    87.0 Mya
  • Uniprot_ID
    Q15935
  • NCBI_ID
    58492
Sequence:
MDCVIFEEVAVNFTPEEWALLDHAQRSLYRDVMLETCRNLASLDCYIYVRTSGSSSQRDVFGNGISNDEEIVKFTGSDSWSIFGENWRFDNTGDQHQIPQRHLRSQLGRLCESNEGHQCGETLSQTANLLVHKSYPTEAKPSECTKCGKAFENRQRSHTGQRPCKECGQACSCLSCQSPPMKTQTVEKPCNCQDSRTASVTYVKSLSSKKSYECQKCGKAFICPSSFRGHVNSHHGQKTHACKVCGKTFMYYSYLTRHVRTHTGEKPYECKECGKAFSCPSYFREHVRTHTGEKPYECKHCGKSFSCYSSFRDHVRTHTGEKPCQCKHCGKAFTCYSSLREHGRTHSGEKPYECKECGKAFRYPSSLRAHMRMHTGEKPYVCKQCGKAFGCPTYFRRHVKTHSGVKPYQCKECGKAYSFSSSLRIHVRTHTGEKPFECKHCGKAFSCHSSLREHVRTHSGEKPYECNQCGKAFSHAQYFQKHVRSHSGVKPYECTECGKAYSCSSSLRVHVRTHTGERPYECKQCGKTFRYLASLQAHVRTHAGA
Domain KRAB, ZF, and degenerated ZF domains of KZFPs. :
...
# Domain name Pos
1 KRAB 4..99
2 C2h2 212..234
3 C2h2 240..262
4 C2h2 268..290
5 C2h2 296..318
6 C2h2 324..346
7 C2h2 352..374
8 C2h2 380..402
9 C2h2 408..430
10 C2h2 436..458
11 C2h2 464..486
12 C2h2 492..514
13 C2h2 520..542
Gene Ontology Annotation The Gene Ontology (GO) describes knowledge of the biological domain based on three aspects: Molecular function, Biological process, and Cellular component. :
# Type TERM
1 Cellular Component nucleus
2 Molecular Function DNA-binding transcription factor activity, RNA polymerase II-specific
3 Molecular Function DNA-binding transcription repressor activity, RNA polymerase II-specific
4 Molecular Function metal ion binding
5 Molecular Function RNA polymerase II transcription regulatory region sequence-specific DNA binding
6 Biological Process negative regulation of transcription by RNA polymerase II
7 Biological Process regulation of transcription by RNA polymerase II
Is there ChIP-seq data Is there any ChIP-seq data available for these KZFPs in the Cistrome database? :
Yes
Motif(meme-ChIP) DNA binding motifs of KZFPs obtained using meme-ChIP and mapped using pylogo. :
Forward:
...
Reverse:
...
Peak overlapping A ChIP-seq peak of KZFPs that intersects with a certain repeats sequences on the genome. :
# Repeats name Record number Significance Emergence time(Mya) Time correlation with KZFP
1 L2a 35 *** 99.0 Moderately correlated
2 AluY 20 n.s 74.0 Weakly correlated
3 MER57E1 16 **** 87.0 Highly correlated
4 AluJb 14 n.s 74.0 Weakly correlated
5 AluYa5 14 **** 15.2 Weakly correlated
6 MIRb 14 n.s 99.0 Moderately correlated
7 L1P3 10 **** 74.0 Weakly correlated
8 L2 9 n.s 99.0 Moderately correlated
9 L2c 9 n.s 99.0 Moderately correlated
10 L1M4c 8 **** 99.0 Moderately correlated
11 AluSc8 7 * 74.0 Weakly correlated
12 MIR 6 n.s 99.0 Moderately correlated
13 AluSx 5 n.s 74.0 Weakly correlated
14 AluSz 5 n.s 74.0 Weakly correlated
15 AluYj4 5 **** 0.0 Weakly correlated
16 L1MC5a 5 * 99.0 Moderately correlated
17 AluJr 4 n.s 74.0 Weakly correlated
18 AluYm1 4 *** 19.6 Weakly correlated
19 LTR10A 4 **** 28.9 Weakly correlated
20 AluSx1 3 n.s 74.0 Weakly correlated
21 AluYb8 3 *** 15.2 Weakly correlated
22 L1MC4 3 n.s 99.0 Moderately correlated
23 L2b 3 n.s 99.0 Moderately correlated
24 LTR10F 3 **** 28.9 Weakly correlated
25 MER21B 3 ** 99.0 Moderately correlated
26 MIR3 3 n.s 99.0 Moderately correlated
27 AluJo 2 n.s 74.0 Weakly correlated
28 AluSp 2 n.s 74.0 Weakly correlated
29 AluSq 2 n.s 74.0 Weakly correlated
30 AluSq2 2 n.s 74.0 Weakly correlated
31 AluYe5 2 *** 74.0 Weakly correlated
32 FLAM_C 2 n.s 74.0 Weakly correlated
33 L1M4b 2 n.s 99.0 Moderately correlated
34 L1MB3 2 n.s 99.0 Moderately correlated
35 L1ME1 2 n.s 99.0 Moderately correlated
36 L1ME4b 2 n.s 99.0 Moderately correlated
37 L1PA2 2 n.s 15.2 Weakly correlated
38 L1PA5 2 n.s 19.6 Weakly correlated
39 MER4-int 2 * 74.0 Weakly correlated
40 MER57D 2 **** 87.0 Highly correlated
41 MER57E2 2 **** 87.0 Highly correlated
42 MIRc 2 n.s 99.0 Moderately correlated
43 MLT1H 2 n.s 99.0 Moderately correlated
44 MLT1L 2 n.s 99.0 Moderately correlated
45 SVA_F 2 ** 0.0 Weakly correlated
46 AluJr4 1 n.s 74.0 Weakly correlated
47 AluSc 1 n.s 74.0 Weakly correlated
48 AluSg 1 n.s 74.0 Weakly correlated
49 AluSg4 1 n.s 74.0 Weakly correlated
50 AluSg7 1 n.s 74.0 Weakly correlated
51 AluYh3 1 * 15.2 Weakly correlated
52 ERVL-E-int 1 n.s 99.0 Moderately correlated
53 HAL1 1 n.s 99.0 Moderately correlated
54 HERV17-int 1 n.s 28.9 Weakly correlated
55 L1HS 1 n.s 8.6 Weakly correlated
56 L1M3 1 n.s 99.0 Moderately correlated
57 L1M4 1 n.s 99.0 Moderately correlated
58 L1MB7 1 n.s 99.0 Moderately correlated
59 L1MB8 1 n.s 99.0 Moderately correlated
60 L1MC1 1 n.s 99.0 Moderately correlated
61 L1MC4a 1 n.s 99.0 Moderately correlated
62 L1MDb 1 * 99.0 Moderately correlated
63 L1ME4a 1 n.s 99.0 Moderately correlated
64 L1P4 1 n.s 74.0 Weakly correlated
65 L1PA13 1 n.s 74.0 Weakly correlated
66 L1PA15 1 n.s 74.0 Weakly correlated
67 L1PA4 1 n.s 19.6 Weakly correlated
68 L1PA7 1 n.s 74.0 Weakly correlated
69 L1PA8 1 n.s 74.0 Weakly correlated
70 L1PB4 1 n.s 99.0 Moderately correlated
71 L3 1 n.s 99.0 Moderately correlated
72 LTR1 1 ** 43.0 Weakly correlated
73 LTR10B1 1 *** 28.9 Weakly correlated
74 LTR13 1 * 19.6 Weakly correlated
75 LTR2C 1 ** 19.6 Weakly correlated
76 LTR33 1 n.s 99.0 Moderately correlated
77 LTR33A 1 * 99.0 Moderately correlated
78 LTR40b 1 ** 99.0 Moderately correlated
79 LTR81C 1 ** 99.0 Moderately correlated
80 LTR85c 1 ** 99.0 Moderately correlated
81 MER11A 1 n.s 28.9 Weakly correlated
82 MER21C 1 n.s 99.0 Moderately correlated
83 MER31-int 1 * 99.0 Moderately correlated
84 MER52A 1 n.s 74.0 Weakly correlated
85 MER52C 1 ** 74.0 Weakly correlated
86 MER57F 1 ** 74.0 Weakly correlated
87 MER61A 1 ** 43.0 Weakly correlated
88 MLT1A0 1 n.s 99.0 Moderately correlated
89 MLT1D 1 n.s 99.0 Moderately correlated
90 MLT1F2 1 n.s 99.0 Moderately correlated
91 MLT1G3-int 1 ** 99.0 Moderately correlated
92 MLT1H-int 1 ** 99.0 Moderately correlated
93 MLT1J 1 n.s 99.0 Moderately correlated
94 MLT2A1 1 n.s 74.0 Weakly correlated
95 MamGypsy2-LTR 1 *** 99.0 Moderately correlated
96 MamRTE1 1 n.s 99.0 Moderately correlated
97 MamRep605 1 n.s 99.0 Moderately correlated
98 PRIMA41-int 1 * 74.0 Weakly correlated
99 Penelope1_Vert 1 ** 319.0 Weakly correlated
100 SVA_B 1 * 15.2 Weakly correlated
101 SVA_D 1 n.s 15.2 Weakly correlated
102 THE1B 1 n.s 43.0 Weakly correlated
Motif in Repeats The motif of KZFPs identified by the MEME-ChIP is present in repeats sequences. :
# Repeats name Record number Significance Emergence time(Mya) Time correlation with KZFP
1 L2c 2 n.s 99.0 Moderately correlated
2 MER57E1 1 ** 87.0 Highly correlated
3 AluSz 1 n.s 74.0 Weakly correlated
4 L1PA2 1 n.s 15.2 Weakly correlated
5 AluSq2 1 n.s 74.0 Weakly correlated
6 L2a 1 n.s 99.0 Moderately correlated
Motif in Repeats Consensus The motif of KZFPs identified by MEME-ChIP analysis can be utilized to locate the corresponding region within the consensus sequences of repeats. :
# Repeats name Emergence time(Mya) Time correlation with KZFP