ZRdb KZFP & Repeats
...

Human_ZNF764

  • Protein
    Zinc finger protein 764
  • Length
    408
  • Organism
    Homo sapiens (Human)
  • Time of emergence
    160.0 Mya
  • Time of Changing in binding specificity
    160.0 Mya
  • Uniprot_ID
    Q96H86
  • NCBI_ID
    92595
Sequence:
MAPPLAPLPPRDPNGAGPEWREPGAVSFADVAVYFCREEWGCLRPAQRALYRDVMRETYGHLSALGIGGNKPALISWVEEEAELWGPAAQDPEVAKCQTQTDPADSRNKKKERQREGTGALEKPDPVAAGSPGLKSPQAPSAGPPYGWEQLSKAPHRGRPSLCAHPPVPRADQRHGCYVCGKSFAWRSTLVEHVYSHTGEKPFHCTDCGKGFGHASSLSKHRAIHRGERPHRCLECGRAFTQRSALTSHLRVHTGEKPYGCADCGRRFSQSSALYQHRRVHSGETPFPCPDCGRAFAYPSDLRRHVRTHTGEKPYPCPDCGRCFRQSSEMAAHRRTHSGEKPYPCPQCGRRFGQKSAVAKHQWVHRPGAGGHRGRVAGRLSVTLTPGHGDLDPPVGFQLYPEIFQECG
Domain KRAB, ZF, and degenerated ZF domains of KZFPs. :
...
# Domain name Pos
1 KRAB 26..97
2 C2h2 175..197
3 C2h2 203..225
4 C2h2 231..253
5 C2h2 259..281
6 C2h2 287..309
7 C2h2 315..337
8 C2h2 343..365
Gene Ontology Annotation The Gene Ontology (GO) describes knowledge of the biological domain based on three aspects: Molecular function, Biological process, and Cellular component. :
# Type TERM
1 Cellular Component nucleus
2 Molecular Function DNA-binding transcription factor activity, RNA polymerase II-specific
3 Molecular Function DNA-binding transcription repressor activity, RNA polymerase II-specific
4 Molecular Function metal ion binding
5 Molecular Function RNA polymerase II transcription regulatory region sequence-specific DNA binding
6 Biological Process negative regulation of transcription by RNA polymerase II
7 Biological Process regulation of transcription by RNA polymerase II
Is there ChIP-seq data Is there any ChIP-seq data available for these KZFPs in the Cistrome database? :
Yes
Motif(meme-ChIP) DNA binding motifs of KZFPs obtained using meme-ChIP and mapped using pylogo. :
Forward:
...
Reverse:
...
Peak overlapping A ChIP-seq peak of KZFPs that intersects with a certain repeats sequences on the genome. :
# Repeats name Record number Significance Emergence time(Mya) Time correlation with KZFP
1 L1PA2 3 * 15.2 Weakly correlated
2 L1PA5 3 n.s 19.6 Weakly correlated
3 LTR10A 3 **** 28.9 Weakly correlated
4 AluSg7 1 * 74.0 Weakly correlated
5 AluSx 1 n.s 74.0 Weakly correlated
6 AluY 1 n.s 74.0 Weakly correlated
7 AluYh9 1 **** 15.2 Weakly correlated
8 AluYj4 1 ** 0.0 Weakly correlated
9 L1ME4a 1 n.s 99.0 Weakly correlated
10 L1P1 1 * 19.6 Weakly correlated
11 L1PA4 1 n.s 19.6 Weakly correlated
12 LTR13 1 ** 19.6 Weakly correlated
13 LTR55 1 *** 99.0 Weakly correlated
14 MER39B 1 ** 74.0 Weakly correlated
15 MIR 1 n.s 99.0 Weakly correlated
16 MIRc 1 n.s 99.0 Weakly correlated
Motif in Repeats The motif of KZFPs identified by the MEME-ChIP is present in repeats sequences. :
# Repeats name Record number Significance Emergence time(Mya) Time correlation with KZFP
1 AluYh9 1 **** 15.2 Weakly correlated
2 AluYj4 1 ** 0.0 Weakly correlated
Motif in Repeats Consensus The motif of KZFPs identified by MEME-ChIP analysis can be utilized to locate the corresponding region within the consensus sequences of repeats. :
# Repeats name Emergence time(Mya) Time correlation with KZFP