ZRdb KZFP & Repeats
...

Human_ZNF737

  • Protein
    Zinc finger protein 737
  • Length
    536
  • Organism
    Homo sapiens (Human)
  • Time of emergence
    28.9 Mya
  • Time of Changing in binding specificity
    28.9 Mya
  • Uniprot_ID
    O75373
  • NCBI_ID
    100129842
Sequence:
MGPLQFRDVAIEFSLEEWHCLDTAQRNLYRNVMLENYRNLVFLGIVVSKPDLITCLEQGKKPLTMKKHEMVANPSVTCSHFARDLWPEQSIKDSFQKVTLRRYENYGHDNLQFKKGCESVDECKVHKRGYNGLNQYLTTTQSKIFQCDKYVKVIHKFSNSNRHKIRHTGKKPFKCIECGKAFNQSSTLTTHKKIHTGEKPFKCEECGKAFNWSSHLTTHKRIHTGEKRYKCEDCGKAFSRFSYLTAHKIIHSGEKPYKCEECGKAFKRSSNLTTHKIIHTGEKPYKCEECGKAFKRSSILTAHKIIHSGEKPYKCEECGKAFKHPSVLTTHKRIHTGEKPYKCEECGRAFKYFSSLTTHKIIHSGEKPYKCEECGKAFNWSSHLTTHKRIHTGEKPYKCEECGEAFKYSSSLTTHKIIHTGQQPFKCEECGKAFKCFSILTTHKRIHTGEKPYKCEECGKAFNSSSHLTAHKRIHTGEKPYKCERCGKAFKRSFILTRHKRIHTGEKPYKCEECGKGFKCPSTLTTHKVIHTGEKL
Domain KRAB, ZF, and degenerated ZF domains of KZFPs. :
...
# Domain name Pos
1 KRAB 4..75
2 C2h2 173..195
3 C2h2 201..223
4 C2h2 229..251
5 C2h2 257..279
6 C2h2 285..307
7 C2h2 313..335
8 C2h2 341..363
9 C2h2 369..391
10 C2h2 397..419
11 C2h2 425..447
12 C2h2 453..475
13 C2h2 481..503
14 C2h2 509..531
Gene Ontology Annotation The Gene Ontology (GO) describes knowledge of the biological domain based on three aspects: Molecular function, Biological process, and Cellular component. :
# Type TERM
1 Cellular Component nucleus
2 Molecular Function DNA-binding transcription factor activity, RNA polymerase II-specific
3 Molecular Function metal ion binding
4 Molecular Function RNA polymerase II cis-regulatory region sequence-specific DNA binding
5 Biological Process regulation of DNA-templated transcription
Is there ChIP-seq data Is there any ChIP-seq data available for these KZFPs in the Cistrome database? :
Yes
Motif(meme-ChIP) DNA binding motifs of KZFPs obtained using meme-ChIP and mapped using pylogo. :
Forward:
...
Reverse:
...
Peak overlapping A ChIP-seq peak of KZFPs that intersects with a certain repeats sequences on the genome. :
# Repeats name Record number Significance Emergence time(Mya) Time correlation with KZFP
1 HERVK14-int 11 **** 28.9 Highly correlated
2 LTR10A 3 **** 28.9 Highly correlated
3 AluY 1 n.s 74.0 Weakly correlated
4 FRAM 1 ** 74.0 Weakly correlated
5 L1P1 1 * 19.6 Weakly correlated
6 L2c 1 n.s 99.0 Weakly correlated
7 LTR13 1 *** 19.6 Weakly correlated
8 MER39B 1 *** 74.0 Weakly correlated
Motif in Repeats The motif of KZFPs identified by the MEME-ChIP is present in repeats sequences. :
# Repeats name Record number Significance Emergence time(Mya) Time correlation with KZFP
1 L1P1 1 * 19.6 Weakly correlated
2 L2c 1 n.s 99.0 Weakly correlated
Motif in Repeats Consensus The motif of KZFPs identified by MEME-ChIP analysis can be utilized to locate the corresponding region within the consensus sequences of repeats. :
# Repeats name Emergence time(Mya) Time correlation with KZFP