ZRdb KZFP & Repeats
...

Human_ZNF728

  • Protein
    Zinc finger protein 728
  • Length
    622
  • Organism
    Homo sapiens (Human)
  • Time of emergence
    43.0 Mya
  • Time of Changing in binding specificity
    19.6 Mya
  • Uniprot_ID
    P0DKX0
  • NCBI_ID
    388523
Sequence:
MGSLTFRDVAIQFSLEEWQCLDTAQQNLYRNVMLENYRNLVFLGIAAPKPDLIIFLEQGKEPWNMKRHELVKEPPVICSHFAQDLWPEQGREDSFQKVILRRYEKCGHENLQLKIGCTNVDECKVHKKGYNKLNQSLTTTQSKVFQCGKYANIFHKCSNSKRHKIRHTGKKLLKCKEYVRSFCMLSHLSQHKRIYTRENSYKSEEHGKAFNWSSALTYKRIHTGEKPCKCEECGKAFSKFSILTKHKVIHTGEKHYKCEECGKAFTRSSSLIEHKRSHAGEKPYKCEECGKAFSKASTLTAHKTIHAGEKPYKCEECGKAFNRSSNLMEHKRIHTGEKPCKCEECGKAFGNFSTLTKHKVIHTGEKPYKCEECGKAFSWPSSLTEHKRIHAGDKPYKCEECGKTFKWSSTLTKHKIIHTGEKPYKCEECGKAFTTFSSLTKHKVIHTGEKHYKCEECGKVFSWSSSLTTHKAIHAGEKLYKCEECGKAFKWSSNLMEHKRIHTGEKPYKCEECGKAFSKVANLTKHKVIHTGEKQYKCEECGKAFIWSSRLSEHKRIHTGEKPYKCEECGKAFSWVSVLNKHKKIHAGKKFYKCEECGKDFNQSSHLTTHKRIHTGGKTLQM
Domain KRAB, ZF, and degenerated ZF domains of KZFPs. :
...
# Domain name Pos
1 KRAB 4..75
2 C2h2 228..250
3 C2h2 256..278
4 C2h2 284..306
5 C2h2 312..334
6 C2h2 340..362
7 C2h2 368..390
8 C2h2 396..418
9 C2h2 424..446
10 C2h2 452..474
11 C2h2 480..502
12 C2h2 508..530
13 C2h2 536..558
14 C2h2 564..586
15 C2h2 592..614
Gene Ontology Annotation The Gene Ontology (GO) describes knowledge of the biological domain based on three aspects: Molecular function, Biological process, and Cellular component. :
# Type TERM
1 Cellular Component nucleus
2 Molecular Function DNA-binding transcription factor activity, RNA polymerase II-specific
3 Molecular Function metal ion binding
4 Molecular Function RNA polymerase II cis-regulatory region sequence-specific DNA binding
5 Biological Process regulation of transcription by RNA polymerase II
Is there ChIP-seq data Is there any ChIP-seq data available for these KZFPs in the Cistrome database? :
Yes
Motif(meme-ChIP) DNA binding motifs of KZFPs obtained using meme-ChIP and mapped using pylogo. :
Forward:
...
Reverse:
...
Peak overlapping A ChIP-seq peak of KZFPs that intersects with a certain repeats sequences on the genome. :
# Repeats name Record number Significance Emergence time(Mya) Time correlation with KZFP
1 HERV9NC-int 50 **** 19.6 Highly correlated
2 HERV9-int 42 **** 28.9 Moderately correlated
3 HERV9N-int 39 **** 19.6 Highly correlated
4 HERV17-int 27 **** 28.9 Moderately correlated
5 AluSc8 8 ** 74.0 Weakly correlated
6 L1P3 8 **** 74.0 Weakly correlated
7 AluYj4 6 **** 0.0 Weakly correlated
8 LTR8 5 **** 43.0 Weakly correlated
9 AluYm1 5 **** 19.6 Highly correlated
10 LTR10A 4 **** 28.9 Moderately correlated
11 AluY 3 n.s 74.0 Weakly correlated
12 FRAM 3 *** 74.0 Weakly correlated
13 HERVIP10FH-int 3 **** 28.9 Moderately correlated
14 AluJb 3 n.s 74.0 Weakly correlated
15 LTR10F 2 **** 28.9 Moderately correlated
16 L1PA5 2 n.s 19.6 Highly correlated
17 MER21B 1 n.s 99.0 Weakly correlated
18 MamGypLTR3a 1 ** 99.0 Weakly correlated
19 MER92B 1 ** 99.0 Weakly correlated
20 MLT1H 1 n.s 99.0 Weakly correlated
21 MLT1L 1 n.s 99.0 Weakly correlated
22 LTR16B1 1 ** 99.0 Weakly correlated
23 LTR13 1 * 19.6 Highly correlated
24 LTR10B1 1 *** 28.9 Moderately correlated
25 L2b 1 n.s 99.0 Weakly correlated
26 L2 1 n.s 99.0 Weakly correlated
27 L1P4 1 n.s 74.0 Weakly correlated
28 L1ME4b 1 n.s 99.0 Weakly correlated
29 L1MC4 1 n.s 99.0 Weakly correlated
30 L1MB8 1 n.s 99.0 Weakly correlated
31 L1M4 1 n.s 99.0 Weakly correlated
32 L1M3 1 n.s 99.0 Weakly correlated
33 HERV30-int 1 ** 28.9 Moderately correlated
34 AluSz 1 n.s 74.0 Weakly correlated
35 AluSx1 1 n.s 74.0 Weakly correlated
36 AluSx 1 n.s 74.0 Weakly correlated
37 AluSq2 1 n.s 74.0 Weakly correlated
38 AluSp 1 n.s 74.0 Weakly correlated
Motif in Repeats The motif of KZFPs identified by the MEME-ChIP is present in repeats sequences. :
# Repeats name Record number Significance Emergence time(Mya) Time correlation with KZFP
1 AluYj4 4 **** 0.0 Weakly correlated
2 HERV9N-int 2 *** 19.6 Highly correlated
3 FRAM 1 n.s 74.0 Weakly correlated
4 AluY 1 n.s 74.0 Weakly correlated
5 HERV9NC-int 1 * 19.6 Highly correlated
Motif in Repeats Consensus The motif of KZFPs identified by MEME-ChIP analysis can be utilized to locate the corresponding region within the consensus sequences of repeats. :
# Repeats name Emergence time(Mya) Time correlation with KZFP