ZRdb KZFP & Repeats
...

Human_ZNF726

  • Protein
    Zinc finger protein 726
  • Length
    616
  • Organism
    Homo sapiens (Human)
  • Time of emergence
    74.0 Mya
  • Time of Changing in binding specificity
    28.9 Mya
  • Uniprot_ID
    A6NNF4
  • NCBI_ID
    730087
Sequence:
MGLLTFRDVAIEFSLEEWQCLDTAQKNLYRNVMLENYRNLAFLGIAVSKPDLIICLEKEKEPWNMKRDEMVDEPPGICPHFAQDIWPEQGVEDSFQKVILRRFEKCGHENLQLRKGCKSVDECKVHKEGYNGLNQCFTTTQGKASQCGKYLKVFYKFINLNRYKIRHTRKKPFKCKNCVKSFCMFSHKTQHKSIYTTEKSYKCKECGKTFNWSSTLTNHKKTHTEEKPYKCEEYGKAFNQSSNYTTHKVTHTGEKPYKCEECGKAFSQSSTLTIHKRIHTGEKPCKCEECGKAFSQPSALTIHKRMHIGEKPYKCEECGKAFVWSSTLTRHKRLHSGEKPYKCEECAKAFSQFGHLTTHRIIHTGEKPYKCEECGKAFIWPSTLTKHKRIHTGEKPYKCEECGKAFHRSSNLTKHKIIHTGEKPYKCEECGKAFIWSSNLTEHKKIHTREKPYKCEECSKAFSRSSALTTHKRMHTGEKPYKCEECGKAFSQSSTLTAHKIIHTGEKPYKCEECGKAFILSSTLSKHKRIHTGEKPYKCEECGKTFNQSSNLSTHKIIHTGEKPYKCEECGKAFNRSSNLSTHKIIHTGEKPYKCDECGKSFIWSSTLFKHKRIHT
Domain KRAB, ZF, and degenerated ZF domains of KZFPs. :
...
# Domain name Pos
1 KRAB 4..75
2 dec2h2 173..195
3 C2h2 201..223
4 dec2h2 229..251
5 C2h2 257..279
6 C2h2 285..307
7 C2h2 313..335
8 C2h2 341..363
9 C2h2 369..391
10 C2h2 397..419
11 C2h2 425..447
12 C2h2 453..475
13 C2h2 481..503
14 C2h2 509..531
15 C2h2 537..559
16 C2h2 565..587
17 C2h2 593..615
Gene Ontology Annotation The Gene Ontology (GO) describes knowledge of the biological domain based on three aspects: Molecular function, Biological process, and Cellular component. :
# Type TERM
1 Cellular Component nucleus
2 Molecular Function DNA-binding transcription factor activity, RNA polymerase II-specific
3 Molecular Function metal ion binding
4 Molecular Function RNA polymerase II cis-regulatory region sequence-specific DNA binding
5 Biological Process regulation of transcription by RNA polymerase II
Is there ChIP-seq data Is there any ChIP-seq data available for these KZFPs in the Cistrome database? :
Yes
Motif(meme-ChIP) DNA binding motifs of KZFPs obtained using meme-ChIP and mapped using pylogo. :
Forward:
...
Reverse:
...
Peak overlapping A ChIP-seq peak of KZFPs that intersects with a certain repeats sequences on the genome. :
# Repeats name Record number Significance Emergence time(Mya) Time correlation with KZFP
1 HERVIP10B3-int 19 **** 28.9 Highly correlated
2 SVA_F 16 **** 0.0 Weakly correlated
3 AluYj4 14 **** 0.0 Weakly correlated
4 HERVIP10F-int 13 **** 28.9 Highly correlated
5 AluJb 12 n.s 74.0 Weakly correlated
6 L1P3 11 **** 74.0 Weakly correlated
7 HERVIP10FH-int 11 **** 28.9 Highly correlated
8 HERVI-int 11 **** 28.9 Highly correlated
9 LTR8 9 **** 43.0 Moderately correlated
10 AluSc8 8 ** 74.0 Weakly correlated
11 AluY 6 n.s 74.0 Weakly correlated
12 FRAM 6 **** 74.0 Weakly correlated
13 SVA_E 4 **** 0.0 Weakly correlated
14 SVA_D 4 ** 15.2 Weakly correlated
15 AluYm1 4 *** 19.6 Weakly correlated
16 LTR10A 4 **** 28.9 Highly correlated
17 L2c 4 n.s 99.0 Weakly correlated
18 AluJo 3 n.s 74.0 Weakly correlated
19 MER21B 3 ** 99.0 Weakly correlated
20 LTR10F 3 **** 28.9 Highly correlated
21 AluYa8 2 **** 15.2 Weakly correlated
22 HERVP71A-int 2 *** 43.0 Moderately correlated
23 L2a 2 n.s 99.0 Weakly correlated
24 LTR13 2 ** 19.6 Weakly correlated
25 AluSx 2 n.s 74.0 Weakly correlated
26 L1PA5 2 n.s 19.6 Weakly correlated
27 L1PA2 2 n.s 15.2 Weakly correlated
28 MER57A-int 1 n.s 43.0 Moderately correlated
29 LTR10B1 1 *** 28.9 Highly correlated
30 ERV3-16A3_I-int 1 n.s 99.0 Weakly correlated
31 LTR12C 1 n.s 19.6 Weakly correlated
32 AluSx3 1 n.s 74.0 Weakly correlated
33 MER101-int 1 * 74.0 Weakly correlated
34 AluYi6 1 *** 15.2 Weakly correlated
35 L2b 1 n.s 99.0 Weakly correlated
36 MIR3 1 n.s 99.0 Weakly correlated
37 MIRb 1 n.s 99.0 Weakly correlated
38 MIRc 1 n.s 99.0 Weakly correlated
39 MLT1L 1 n.s 99.0 Weakly correlated
40 SVA_C 1 * 15.2 Weakly correlated
41 AluYb8 1 n.s 15.2 Weakly correlated
42 AluSz 1 n.s 74.0 Weakly correlated
43 FLAM_C 1 n.s 74.0 Weakly correlated
44 HERV17-int 1 n.s 28.9 Highly correlated
45 AluSq 1 n.s 74.0 Weakly correlated
46 L2 1 n.s 99.0 Weakly correlated
47 L1PB 1 n.s 74.0 Weakly correlated
48 L1PA7 1 n.s 74.0 Weakly correlated
49 L1PA4 1 n.s 19.6 Weakly correlated
50 L1PA10 1 n.s 74.0 Weakly correlated
51 L1P4 1 n.s 74.0 Weakly correlated
52 L1MC4 1 n.s 99.0 Weakly correlated
53 L1MB8 1 n.s 99.0 Weakly correlated
54 L1MA9 1 n.s 99.0 Weakly correlated
55 L1M3 1 n.s 99.0 Weakly correlated
56 L1HS 1 n.s 8.6 Weakly correlated
57 AluSg7 1 n.s 74.0 Weakly correlated
58 AluSp 1 n.s 74.0 Weakly correlated
Motif in Repeats The motif of KZFPs identified by the MEME-ChIP is present in repeats sequences. :
# Repeats name Record number Significance Emergence time(Mya) Time correlation with KZFP
1 AluYj4 3 *** 0.0 Weakly correlated
2 FRAM 2 * 74.0 Weakly correlated
3 AluSc8 2 n.s 74.0 Weakly correlated
4 AluSq 1 n.s 74.0 Weakly correlated
5 AluY 1 n.s 74.0 Weakly correlated
Motif in Repeats Consensus The motif of KZFPs identified by MEME-ChIP analysis can be utilized to locate the corresponding region within the consensus sequences of repeats. :
# Repeats name Emergence time(Mya) Time correlation with KZFP