ZRdb KZFP & Repeats
...

Human_ZNF718

  • Protein
    Zinc finger protein 718
  • Length
    478
  • Organism
    Homo sapiens (Human)
  • Time of emergence
    28.9 Mya
  • Time of Changing in binding specificity
    19.6 Mya
  • Uniprot_ID
    Q3SXZ3
  • NCBI_ID
    255403
Sequence:
MELLTFKDVAIEFSPEEWKCLDTSQQNLYRDVMLENYRNLVSLGVSISNPDLVTSLEQRKEPYNLKIHETAARPPAVCSHFTQNLWTVQGIEDSFHKLIPKGHEKRGHENLRKTCKSINECKVQKGGYNRINQCLLTTQKKTIQSNICVKVFHKFSNSNKDKIRYTGDKTFKCKECGKSFHVLSRLTQHKRIHTGENPYTCEECGKAFNWSSILTKHKRIHAREKFYKCEECGKGFTRSSHLTKHKRIHTGEKPYICEKCGKAFNQSSTLNLHKRIHSAQKYYKCEECGKAFKWSSSLNEHKRIHAGEKPFSCEECGNVFTTSSDFAKHKRIHTGEKPYKCEECGKSFNRSTTLTTHKRIHTGEKPYTCEECGKAFNWSSTLNVHKRIHSGKNPYKCEDCGKAFKVFANLHNHKKIHTGEKPYICKQCGKAFKQSSHLNKHKKIHTVDKPYKCKECGKAFKQYSNLPQHKRTHTGGKF
Domain KRAB, ZF, and degenerated ZF domains of KZFPs. :
...
# Domain name Pos
1 KRAB 4..75
2 C2h2 171..193
3 C2h2 199..221
4 C2h2 227..249
5 C2h2 255..277
6 C2h2 283..305
7 C2h2 311..333
8 C2h2 339..361
9 C2h2 367..389
10 C2h2 395..417
11 C2h2 423..445
12 C2h2 451..473
Gene Ontology Annotation The Gene Ontology (GO) describes knowledge of the biological domain based on three aspects: Molecular function, Biological process, and Cellular component. :
# Type TERM
1 Cellular Component nucleus
2 Molecular Function DNA-binding transcription factor activity, RNA polymerase II-specific
3 Molecular Function metal ion binding
4 Molecular Function RNA polymerase II cis-regulatory region sequence-specific DNA binding
5 Biological Process regulation of DNA-templated transcription
Is there ChIP-seq data Is there any ChIP-seq data available for these KZFPs in the Cistrome database? :
Yes
Motif(meme-ChIP) DNA binding motifs of KZFPs obtained using meme-ChIP and mapped using pylogo. :
Forward:
...
Reverse:
...
Peak overlapping A ChIP-seq peak of KZFPs that intersects with a certain repeats sequences on the genome. :
# Repeats name Record number Significance Emergence time(Mya) Time correlation with KZFP
1 AluJb 16 n.s 74.0 Weakly correlated
2 L1P3 10 **** 74.0 Weakly correlated
3 MER52-int 10 **** 99.0 Weakly correlated
4 LTR8 10 **** 43.0 Weakly correlated
5 AluSc8 7 n.s 74.0 Weakly correlated
6 L2c 7 n.s 99.0 Weakly correlated
7 MER21B 5 *** 99.0 Weakly correlated
8 AluYj4 5 **** 0.0 Weakly correlated
9 AluJr 4 n.s 74.0 Weakly correlated
10 AluY 4 n.s 74.0 Weakly correlated
11 LTR10A 4 **** 28.9 Moderately correlated
12 L1MB8 3 n.s 99.0 Weakly correlated
13 HAL1 3 n.s 99.0 Weakly correlated
14 SVA_D 3 * 15.2 Weakly correlated
15 LTR25-int 2 ** 43.0 Weakly correlated
16 MIRb 2 n.s 99.0 Weakly correlated
17 MIRc 2 n.s 99.0 Weakly correlated
18 L1PA8A 2 n.s 74.0 Weakly correlated
19 L1PA5 2 n.s 19.6 Highly correlated
20 SVA_F 2 * 0.0 Weakly correlated
21 L1PA2 2 n.s 15.2 Weakly correlated
22 L1M4 2 n.s 99.0 Weakly correlated
23 AluSc 2 n.s 74.0 Weakly correlated
24 AluSx1 2 n.s 74.0 Weakly correlated
25 ERV3-16A3_I-int 2 n.s 99.0 Weakly correlated
26 FRAM 2 * 74.0 Weakly correlated
27 AluSx 1 n.s 74.0 Weakly correlated
28 AluYa8 1 *** 15.2 Weakly correlated
29 AluSz 1 n.s 74.0 Weakly correlated
30 MER50 1 n.s 43.0 Weakly correlated
31 MER68 1 n.s 99.0 Weakly correlated
32 MIR 1 n.s 99.0 Weakly correlated
33 MIR3 1 n.s 99.0 Weakly correlated
34 AluYh9 1 **** 15.2 Weakly correlated
35 AluSp 1 n.s 74.0 Weakly correlated
36 MLT1A1 1 n.s 87.0 Weakly correlated
37 MLT1E3 1 n.s 99.0 Weakly correlated
38 MLT1L 1 n.s 99.0 Weakly correlated
39 SVA_E 1 * 0.0 Weakly correlated
40 AluJo 1 n.s 74.0 Weakly correlated
41 LTR3B_ 1 ** 28.9 Moderately correlated
42 L1MA8 1 n.s 87.0 Weakly correlated
43 LTR13 1 * 19.6 Highly correlated
44 LTR12C 1 n.s 19.6 Highly correlated
45 LTR10B1 1 *** 28.9 Moderately correlated
46 L2b 1 n.s 99.0 Weakly correlated
47 L2a 1 n.s 99.0 Weakly correlated
48 HUERS-P3-int 1 n.s 43.0 Weakly correlated
49 L1HS 1 n.s 8.6 Weakly correlated
50 L1PA4 1 n.s 19.6 Highly correlated
51 L1M3 1 n.s 99.0 Weakly correlated
52 L1PA10 1 n.s 74.0 Weakly correlated
53 L1P4 1 n.s 74.0 Weakly correlated
54 L1MEf 1 n.s 99.0 Weakly correlated
55 L1MC4 1 n.s 99.0 Weakly correlated
Motif in Repeats The motif of KZFPs identified by the MEME-ChIP is present in repeats sequences. :
# Repeats name Record number Significance Emergence time(Mya) Time correlation with KZFP
1 AluSc8 4 n.s 74.0 Weakly correlated
2 MER52-int 1 * 99.0 Weakly correlated
Motif in Repeats Consensus The motif of KZFPs identified by MEME-ChIP analysis can be utilized to locate the corresponding region within the consensus sequences of repeats. :
# Repeats name Emergence time(Mya) Time correlation with KZFP