ZRdb KZFP & Repeats
...

Human_ZNF689

  • Protein
    Zinc finger protein 689
  • Length
    500
  • Organism
    Homo sapiens (Human)
  • Time of emergence
    99.0 Mya
  • Time of Changing in binding specificity
    99.0 Mya
  • Uniprot_ID
    Q96CS4
  • NCBI_ID
    115509
Sequence:
MAPPSAPLPAQGPGKARPSRKRGRRPRALKFVDVAVYFSPEEWGCLRPAQRALYRDVMRETYGHLGALGCAGPKPALISWLERNTDDWEPAALDPQEYPRGLTVQRKSRTRKKNGEKEVFPPKEAPRKGKRGRRPSKPRLIPRQTSGGPICPDCGCTFPDHQALESHKCAQNLKKPYPCPDCGRRFSYPSLLVSHRRAHSGECPYVCDQCGKRFSQRKNLSQHQVIHTGEKPYHCPDCGRCFRRSRSLANHRTTHTGEKPHQCPSCGRRFAYPSLLAIHQRTHTGEKPYTCLECNRRFRQRTALVIHQRIHTGEKPYPCPDCERRFSSSSRLVSHRRVHSGERPYACEHCEARFSQRSTLLQHQLLHTGEKPYPCPDCGRAFRRSGSLAIHRSTHTEEKLHACDDCGRRFAYPSLLASHRRVHSGERPYACDLCSKRFAQWSHLAQHQLLHTGEKPFPCLECGRCFRQRWSLAVHKCSPKAPNCSPRSAIGGSSQRGNAH
Domain KRAB, ZF, and degenerated ZF domains of KZFPs. :
...
# Domain name Pos
1 KRAB 29..100
2 dec2h2 149..171
3 C2h2 177..199
4 C2h2 205..227
5 C2h2 233..255
6 C2h2 261..283
7 C2h2 289..311
8 C2h2 317..339
9 C2h2 345..367
10 C2h2 373..395
11 C2h2 401..423
12 C2h2 429..451
13 dec2h2 457..477
Gene Ontology Annotation The Gene Ontology (GO) describes knowledge of the biological domain based on three aspects: Molecular function, Biological process, and Cellular component. :
# Type TERM
1 Cellular Component nucleus
2 Molecular Function DNA-binding transcription factor activity, RNA polymerase II-specific
3 Molecular Function metal ion binding
4 Molecular Function RNA polymerase II cis-regulatory region sequence-specific DNA binding
5 Biological Process regulation of transcription by RNA polymerase II
6 Biological Process skeletal muscle cell differentiation
Is there ChIP-seq data Is there any ChIP-seq data available for these KZFPs in the Cistrome database? :
Yes
Motif(meme-ChIP) DNA binding motifs of KZFPs obtained using meme-ChIP and mapped using pylogo. :
Forward:
...
Reverse:
...
Peak overlapping A ChIP-seq peak of KZFPs that intersects with a certain repeats sequences on the genome. :
# Repeats name Record number Significance Emergence time(Mya) Time correlation with KZFP
1 L1P3 11 **** 74.0 Weakly correlated
2 AluSc8 10 **** 74.0 Weakly correlated
3 AluYj4 9 **** 0.0 Weakly correlated
4 AluSp 8 * 74.0 Weakly correlated
5 AluY 7 n.s 74.0 Weakly correlated
6 LTR8 6 **** 43.0 Weakly correlated
7 AluJb 5 n.s 74.0 Weakly correlated
8 L2c 5 n.s 99.0 Highly correlated
9 LTR10A 4 **** 28.9 Weakly correlated
10 MER21B 4 **** 99.0 Highly correlated
11 LTR10F 3 **** 28.9 Weakly correlated
12 L1MC4 3 n.s 99.0 Highly correlated
13 L1M5 3 n.s 99.0 Highly correlated
14 AluYm1 3 *** 19.6 Weakly correlated
15 L1M3 3 ** 99.0 Highly correlated
16 FRAM 3 *** 74.0 Weakly correlated
17 AluJo 2 n.s 74.0 Weakly correlated
18 AluJr4 2 n.s 74.0 Weakly correlated
19 AluSz6 2 n.s 74.0 Weakly correlated
20 L1M1 2 n.s 74.0 Weakly correlated
21 AluYa8 1 **** 15.2 Weakly correlated
22 SVA_C 1 ** 15.2 Weakly correlated
23 MLT1L 1 n.s 99.0 Highly correlated
24 MIRc 1 n.s 99.0 Highly correlated
25 AluJr 1 n.s 74.0 Weakly correlated
26 MER11A 1 * 28.9 Weakly correlated
27 AluSg 1 n.s 74.0 Weakly correlated
28 LTR10B1 1 *** 28.9 Weakly correlated
29 AluSx1 1 n.s 74.0 Weakly correlated
30 L2a 1 n.s 99.0 Highly correlated
31 L1PA2 1 n.s 15.2 Weakly correlated
32 L1PA17 1 n.s 74.0 Weakly correlated
33 L1P4 1 n.s 74.0 Weakly correlated
34 L1MEd 1 n.s 99.0 Highly correlated
35 L1MEc 1 n.s 99.0 Highly correlated
36 L1ME4a 1 n.s 99.0 Highly correlated
37 L1ME2 1 n.s 99.0 Highly correlated
38 L1MD2 1 n.s 99.0 Highly correlated
39 L1MD1 1 n.s 99.0 Highly correlated
40 L1MD 1 n.s 99.0 Highly correlated
41 AluYh3 1 * 15.2 Weakly correlated
42 L1MC 1 n.s 99.0 Highly correlated
43 L1MA5A 1 n.s 87.0 Weakly correlated
44 AluYi6 1 *** 15.2 Weakly correlated
45 ERV3-16A3_I-int 1 n.s 99.0 Highly correlated
46 L1M2 1 n.s 99.0 Highly correlated
Motif in Repeats The motif of KZFPs identified by the MEME-ChIP is present in repeats sequences. :
# Repeats name Record number Significance Emergence time(Mya) Time correlation with KZFP
1 AluY 1 n.s 74.0 Weakly correlated
2 FRAM 1 * 74.0 Weakly correlated
3 AluSc8 1 n.s 74.0 Weakly correlated
4 AluYj4 1 * 0.0 Weakly correlated
Motif in Repeats Consensus The motif of KZFPs identified by MEME-ChIP analysis can be utilized to locate the corresponding region within the consensus sequences of repeats. :
# Repeats name Emergence time(Mya) Time correlation with KZFP