ZRdb KZFP & Repeats
...

Human_ZNF688

  • Protein
    Zinc finger protein 688
  • Length
    276
  • Organism
    Homo sapiens (Human)
  • Time of emergence
    160.0 Mya
  • Time of Changing in binding specificity
    160.0 Mya
  • Uniprot_ID
    P0C7X2
  • NCBI_ID
    146542
Sequence:
MAPPPAPLLAPRPGETRPGCRKPGTVSFADVAVYFSPEEWGCLRPAQRALYRDVMQETYGHLGALGFPGPKPALISWMEQESEAWSPAAQDPEKGERLGGARRGDVPNRKEEEPEEVPRAKGPRKAPVKESPEVLVERNPDPAISVAPARAQPPKNAAWDPTTGAQPPAPIPSMDAQAGQRRHVCTDCGRRFTYPSLLVSHRRMHSGERPFPCPECGMRFKRKFAVEAHQWIHRSCSGGRRGRRPGIRAVPRAPVRGDRDPPVLFRHYPDIFEECG
Domain KRAB, ZF, and degenerated ZF domains of KZFPs. :
...
# Domain name Pos
1 KRAB 26..97
2 C2h2 183..205
3 C2h2 211..233
Gene Ontology Annotation The Gene Ontology (GO) describes knowledge of the biological domain based on three aspects: Molecular function, Biological process, and Cellular component. :
# Type TERM
1 Cellular Component nucleus
2 Molecular Function DNA-binding transcription factor activity, RNA polymerase II-specific
3 Molecular Function DNA-binding transcription repressor activity, RNA polymerase II-specific
4 Molecular Function metal ion binding
5 Molecular Function RNA polymerase II transcription regulatory region sequence-specific DNA binding
6 Biological Process negative regulation of transcription by RNA polymerase II
7 Biological Process regulation of transcription by RNA polymerase II
Is there ChIP-seq data Is there any ChIP-seq data available for these KZFPs in the Cistrome database? :
Yes
Motif(meme-ChIP) DNA binding motifs of KZFPs obtained using meme-ChIP and mapped using pylogo. :
Forward:
...
Reverse:
...
Peak overlapping A ChIP-seq peak of KZFPs that intersects with a certain repeats sequences on the genome. :
# Repeats name Record number Significance Emergence time(Mya) Time correlation with KZFP
1 LTR8 13 **** 43.0 Weakly correlated
2 AluSc8 8 *** 74.0 Weakly correlated
3 AluYj4 8 **** 0.0 Weakly correlated
4 FRAM 4 **** 74.0 Weakly correlated
5 L1P3 4 ** 74.0 Weakly correlated
6 LTR10A 4 **** 28.9 Weakly correlated
7 AluY 3 n.s 74.0 Weakly correlated
8 AluYm1 3 ** 19.6 Weakly correlated
9 MER21B 3 ** 99.0 Weakly correlated
10 L1PA5 3 n.s 19.6 Weakly correlated
11 AluYa8 2 **** 15.2 Weakly correlated
12 SVA_C 1 * 15.2 Weakly correlated
13 AluJo 1 n.s 74.0 Weakly correlated
14 MLT1L 1 n.s 99.0 Weakly correlated
15 LTR10B1 1 *** 28.9 Weakly correlated
16 L1PA4 1 n.s 19.6 Weakly correlated
17 L1PA10 1 n.s 74.0 Weakly correlated
18 L1M3 1 n.s 99.0 Weakly correlated
19 L1HS 1 n.s 8.6 Weakly correlated
20 HERV17-int 1 * 28.9 Weakly correlated
21 AluYi6 1 *** 15.2 Weakly correlated
Motif in Repeats The motif of KZFPs identified by the MEME-ChIP is present in repeats sequences. :
# Repeats name Record number Significance Emergence time(Mya) Time correlation with KZFP
1 AluYj4 4 **** 0.0 Weakly correlated
2 FRAM 2 ** 74.0 Weakly correlated
3 AluSc8 2 n.s 74.0 Weakly correlated
4 AluJo 1 n.s 74.0 Weakly correlated
5 AluY 1 n.s 74.0 Weakly correlated
6 AluYa8 1 *** 15.2 Weakly correlated
Motif in Repeats Consensus The motif of KZFPs identified by MEME-ChIP analysis can be utilized to locate the corresponding region within the consensus sequences of repeats. :
# Repeats name Emergence time(Mya) Time correlation with KZFP