ZRdb KZFP & Repeats
...

Human_ZNF615

  • Protein
    Zinc finger protein 615
  • Length
    731
  • Organism
    Homo sapiens (Human)
  • Time of emergence
    99.0 Mya
  • Time of Changing in binding specificity
    99.0 Mya
  • Uniprot_ID
    Q8N8J6
  • NCBI_ID
    284370
Sequence:
MMQAQESLTLEDVAVDFTWEEWQFLSPAQKDLYRDVMLENYSNLVAVGYQASKPDALSKLERGEETCTTEDEIYSRICSEIRKIDDPLQHHLQNQSIQKSVKQCHEQNMFGNIVNQNKGHFLLKQDCDTFDLHEKPLKSNLSFENQKRSSGLKNSAEFNRDGKSLFHANHKQFYTEMKFPAIAKPINKSQFIKQQRTHNIENAHVCSECGKAFLKLSQFIDHQRVHTGEKPHVCSMCGKAFSRKSRLMDHQRTHTELKHYECTECDKTFLKKSQLNIHQKTHMGGKPYTCSQCGKAFIKKCRLIYHQRTHTGEKPHGCSVCGKAFSTKFSLTTHQKTHTGEKPYICSECGKGFIEKRRLTAHHRTHTGEKPFICNKCGKGFTLKNSLITHQQTHTGEKLYTCSECGKGFSMKHCLMVHQRTHTGEKPYKCNECGKGFALKSPLIRHQRTHTGEKPYVCTECRKGFTMKSDLIVHQRTHTAEKPYICNDCGKGFTVKSRLIVHQRTHTGEKPYVCGECGKGFPAKIRLMGHQRTHTGEKPYICNECGKGFTEKSHLNVHRRTHTGEKPYVCSECGKGLTGKSMLIAHQRTHTGEKPYICNECGKGFTMKSTLSIHQQTHTGEKPYKCNECDKTFRKKTCLIQHQRFHTGKTSFACTECGKFSLRKNDLITHQRIHTGEKPYKCSDCGKAFTTKSGLNVHQRKHTGERPYGCSDCGKAFAHLSILVKHRRIHR
Domain KRAB, ZF, and degenerated ZF domains of KZFPs. :
...
# Domain name Pos
1 KRAB 8..79
2 C2h2 204..226
3 C2h2 232..254
4 C2h2 260..282
5 C2h2 288..310
6 C2h2 316..338
7 C2h2 344..366
8 C2h2 372..394
9 C2h2 400..422
10 C2h2 428..450
11 C2h2 456..478
12 C2h2 484..506
13 C2h2 512..534
14 C2h2 540..562
15 C2h2 568..590
16 C2h2 596..618
17 C2h2 624..646
18 C2h2 652..674
19 C2h2 680..702
20 C2h2 708..730
Gene Ontology Annotation The Gene Ontology (GO) describes knowledge of the biological domain based on three aspects: Molecular function, Biological process, and Cellular component. :
# Type TERM
1 Cellular Component nucleus
2 Molecular Function DNA-binding transcription activator activity, RNA polymerase II-specific
3 Molecular Function metal ion binding
4 Molecular Function RNA polymerase II cis-regulatory region sequence-specific DNA binding
5 Biological Process regulation of transcription by RNA polymerase II
Is there ChIP-seq data Is there any ChIP-seq data available for these KZFPs in the Cistrome database? :
Yes
Motif(meme-ChIP) DNA binding motifs of KZFPs obtained using meme-ChIP and mapped using pylogo. :
Forward:
...
Reverse:
...
Peak overlapping A ChIP-seq peak of KZFPs that intersects with a certain repeats sequences on the genome. :
# Repeats name Record number Significance Emergence time(Mya) Time correlation with KZFP
1 L1MC3 34 **** 99.0 Highly correlated
2 AluJb 6 n.s 74.0 Weakly correlated
3 L2c 4 n.s 99.0 Highly correlated
4 LTR10A 3 **** 28.9 Weakly correlated
5 MER68B 3 **** 99.0 Highly correlated
6 L1PA5 3 n.s 19.6 Weakly correlated
7 AluSx1 2 n.s 74.0 Weakly correlated
8 LTR10F 2 **** 28.9 Weakly correlated
9 L1PA2 2 n.s 15.2 Weakly correlated
10 MER39B 1 ** 74.0 Weakly correlated
11 LTR13 1 ** 19.6 Weakly correlated
12 LTR33 1 * 99.0 Highly correlated
13 L2 1 n.s 99.0 Highly correlated
14 MER50-int 1 ** 43.0 Weakly correlated
15 MER68 1 ** 99.0 Highly correlated
16 MIR 1 n.s 99.0 Highly correlated
17 MLT1F 1 * 99.0 Highly correlated
18 MLT1F1 1 ** 99.0 Highly correlated
19 L2a 1 n.s 99.0 Highly correlated
20 L1PA4 1 n.s 19.6 Weakly correlated
21 L1P4 1 * 74.0 Weakly correlated
22 L1P1 1 n.s 19.6 Weakly correlated
23 L1MEd 1 n.s 99.0 Highly correlated
24 L1ME4b 1 n.s 99.0 Highly correlated
25 L1MB8 1 n.s 99.0 Highly correlated
26 AluYm1 1 * 19.6 Weakly correlated
27 AluSp 1 n.s 74.0 Weakly correlated
28 AluSc8 1 n.s 74.0 Weakly correlated
Motif in Repeats The motif of KZFPs identified by the MEME-ChIP is present in repeats sequences. :
# Repeats name Record number Significance Emergence time(Mya) Time correlation with KZFP
1 L1MC3 32 **** 99.0 Highly correlated
2 L1MB8 1 n.s 99.0 Highly correlated
3 MER68B 1 *** 99.0 Highly correlated
4 L2a 1 n.s 99.0 Highly correlated
Motif in Repeats Consensus The motif of KZFPs identified by MEME-ChIP analysis can be utilized to locate the corresponding region within the consensus sequences of repeats. :
# Repeats name Emergence time(Mya) Time correlation with KZFP
1 L1MC3 99.0 Highly correlated