ZRdb KZFP & Repeats
...

Human_ZNF613

  • Protein
    Zinc finger protein 613
  • Length
    617
  • Organism
    Homo sapiens (Human)
  • Time of emergence
    99.0 Mya
  • Time of Changing in binding specificity
    99.0 Mya
  • Uniprot_ID
    Q6PF04
  • NCBI_ID
    79898
Sequence:
MIKSQESLTLEDVAVEFTWEEWQLLGPAQKDLYRDVMLENYSNLVSVGYQASKPDALFKLEQGEPWTVENEIHSQICPEIKKVDNHLQMHSQKQRCLKRVEQCHKHNAFGNIIHQRKSDFPLRQNHDTFDLHGKILKSNLSLVNQNKRYEIKNSVGVNGDGKSFLHAKHEQFHNEMNFPEGGNSVNTNSQFIKHQRTQNIDKPHVCTECGKAFLKKSRLIYHQRVHTGEKPHGCSICGKAFSRKSGLTEHQRNHTGEKPYECTECDKAFRWKSQLNAHQKIHTGEKSYICSDCGKGFIKKSRLINHQRVHTGEKPHGCSLCGKAFSKRSRLTEHQRTHTGEKPYECTECDKAFRWKSQLNAHQKAHTGEKSYICRDCGKGFIQKGNLIVHQRIHTGEKPYICNECGKGFIQKGNLLIHRRTHTGEKPYVCNECGKGFSQKTCLISHQRFHTGKTPFVCTECGKSCSHKSGLINHQRIHTGEKPYTCSDCGKAFRDKSCLNRHRRTHTGERPYGCSDCGKAFSHLSCLVYHKGMLHAREKCVGSVKLENPCSESHSLSHTRDLIQDKDSVNMVTLQMPSVAAQTSLTNSAFQAESKVAIVSQPVARSSVSADSRICTE
Domain KRAB, ZF, and degenerated ZF domains of KZFPs. :
...
# Domain name Pos
1 KRAB 8..78
2 C2h2 204..226
3 C2h2 232..254
4 C2h2 260..282
5 C2h2 288..310
6 C2h2 316..338
7 C2h2 344..366
8 C2h2 372..394
9 C2h2 400..422
10 C2h2 428..450
11 C2h2 456..478
12 C2h2 484..506
13 C2h2 512..535
Gene Ontology Annotation The Gene Ontology (GO) describes knowledge of the biological domain based on three aspects: Molecular function, Biological process, and Cellular component. :
# Type TERM
1 Cellular Component nucleus
2 Molecular Function DNA-binding transcription factor activity
3 Molecular Function metal ion binding
4 Molecular Function RNA polymerase II cis-regulatory region sequence-specific DNA binding
5 Biological Process regulation of transcription by RNA polymerase II
Is there ChIP-seq data Is there any ChIP-seq data available for these KZFPs in the Cistrome database? :
Yes
Motif(meme-ChIP) DNA binding motifs of KZFPs obtained using meme-ChIP and mapped using pylogo. :
Forward:
...
Reverse:
...
Peak overlapping A ChIP-seq peak of KZFPs that intersects with a certain repeats sequences on the genome. :
# Repeats name Record number Significance Emergence time(Mya) Time correlation with KZFP
1 AluJb 15 * 74.0 Weakly correlated
2 AluY 15 * 74.0 Weakly correlated
3 AluSx 9 n.s 74.0 Weakly correlated
4 AluSx1 9 n.s 74.0 Weakly correlated
5 AluSz 8 n.s 74.0 Weakly correlated
6 L2c 7 n.s 99.0 Highly correlated
7 L1MDa 7 **** 99.0 Highly correlated
8 AluJr 5 n.s 74.0 Weakly correlated
9 LTR40c 5 **** 99.0 Highly correlated
10 L1PA5 4 n.s 19.6 Weakly correlated
11 L2a 4 n.s 99.0 Highly correlated
12 L2b 4 n.s 99.0 Highly correlated
13 LTR10A 4 **** 28.9 Weakly correlated
14 LTR40a 4 **** 99.0 Highly correlated
15 L1ME1 4 n.s 99.0 Highly correlated
16 AluJo 4 n.s 74.0 Weakly correlated
17 Alu 3 **** 74.0 Weakly correlated
18 AluSz6 3 n.s 74.0 Weakly correlated
19 LTR40b 3 **** 99.0 Highly correlated
20 AluYj4 3 **** 0.0 Weakly correlated
21 L1MD1 3 * 99.0 Highly correlated
22 MIRb 3 n.s 99.0 Highly correlated
23 MIRc 3 n.s 99.0 Highly correlated
24 AluSc8 3 n.s 74.0 Weakly correlated
25 MIR1_Amn 2 ** 319.0 Weakly correlated
26 L1M4 2 n.s 99.0 Highly correlated
27 L1MA7 2 n.s 87.0 Weakly correlated
28 MIR 2 n.s 99.0 Highly correlated
29 L1MB5 2 n.s 99.0 Highly correlated
30 L1MEg 2 n.s 99.0 Highly correlated
31 AluSg 2 n.s 74.0 Weakly correlated
32 L1ME4b 2 n.s 99.0 Highly correlated
33 AluSp 2 n.s 74.0 Weakly correlated
34 AluSg7 2 * 74.0 Weakly correlated
35 MIR3 2 n.s 99.0 Highly correlated
36 AluSc 2 n.s 74.0 Weakly correlated
37 HERVK-int 2 *** 28.9 Weakly correlated
38 FLAM_A 2 * 74.0 Weakly correlated
39 MLT1H 2 * 99.0 Highly correlated
40 AluYc 2 ** 74.0 Weakly correlated
41 AluSq2 2 n.s 74.0 Weakly correlated
42 AluSx3 2 n.s 74.0 Weakly correlated
43 PABL_A 1 ** 43.0 Weakly correlated
44 L3 1 n.s 99.0 Highly correlated
45 L4_C_Mam 1 * 99.0 Highly correlated
46 L2 1 n.s 99.0 Highly correlated
47 LTR12C 1 n.s 19.6 Weakly correlated
48 LTR13 1 ** 19.6 Weakly correlated
49 LTR25 1 *** 43.0 Weakly correlated
50 MamRTE1 1 n.s 99.0 Highly correlated
51 MamRep605 1 * 99.0 Highly correlated
52 LTR62 1 *** 74.0 Weakly correlated
53 MER39B 1 ** 74.0 Weakly correlated
54 MER4C 1 ** 74.0 Weakly correlated
55 MER54B 1 ** 87.0 Weakly correlated
56 MER57-int 1 * 87.0 Weakly correlated
57 MER61B 1 *** 43.0 Weakly correlated
58 MLT1A 1 n.s 99.0 Highly correlated
59 MLT1A0 1 n.s 99.0 Highly correlated
60 MLT1B 1 n.s 99.0 Highly correlated
61 MLT1C 1 n.s 94.0 Weakly correlated
62 MLT1G 1 * 99.0 Highly correlated
63 MLT2C2 1 ** 99.0 Highly correlated
64 L1M1 1 n.s 74.0 Weakly correlated
65 L1MB8 1 n.s 99.0 Highly correlated
66 L1MB7 1 n.s 99.0 Highly correlated
67 L1MB2 1 n.s 99.0 Highly correlated
68 L1MA5A 1 n.s 87.0 Weakly correlated
69 L1M4a1 1 * 99.0 Highly correlated
70 L1M3de 1 ** 99.0 Highly correlated
71 L1M3c 1 * 99.0 Highly correlated
72 L1M3a 1 ** 99.0 Highly correlated
73 L1MC2 1 n.s 99.0 Highly correlated
74 HERVK22-int 1 * 43.0 Weakly correlated
75 HAL1b 1 n.s 99.0 Highly correlated
76 FLAM_C 1 n.s 74.0 Weakly correlated
77 ERV3-16A3_I-int 1 n.s 99.0 Highly correlated
78 CR1_Mam 1 ** 99.0 Highly correlated
79 AluSx4 1 n.s 74.0 Weakly correlated
80 AluSq10 1 ** 74.0 Weakly correlated
81 AluSg4 1 n.s 74.0 Weakly correlated
82 L1ME3D 1 n.s 99.0 Highly correlated
83 L1PA2 1 n.s 15.2 Weakly correlated
84 L1PA16 1 n.s 74.0 Weakly correlated
85 L1PA15-16 1 n.s 74.0 Weakly correlated
86 L1PA15 1 n.s 74.0 Weakly correlated
87 L1P1 1 n.s 19.6 Weakly correlated
88 L1MEi 1 n.s 99.0 Highly correlated
89 L1ME4c 1 n.s 99.0 Highly correlated
90 L1ME3E 1 n.s 99.0 Highly correlated
91 L1PB2 1 n.s 74.0 Weakly correlated
92 L1ME3Cz 1 n.s 99.0 Highly correlated
93 L1ME3C 1 * 99.0 Highly correlated
94 L1ME2z 1 n.s 99.0 Highly correlated
95 L1MD2 1 n.s 99.0 Highly correlated
96 L1MC5 1 n.s 99.0 Highly correlated
97 L1MC4 1 n.s 99.0 Highly correlated
98 L1MC3 1 n.s 99.0 Highly correlated
Motif in Repeats The motif of KZFPs identified by the MEME-ChIP is present in repeats sequences. :
# Repeats name Record number Significance Emergence time(Mya) Time correlation with KZFP
1 AluSz 2 n.s 74.0 Weakly correlated
2 AluSx3 1 n.s 74.0 Weakly correlated
3 AluYc 1 * 74.0 Weakly correlated
4 L2a 1 n.s 99.0 Highly correlated
5 AluJb 1 n.s 74.0 Weakly correlated
6 AluSx1 1 n.s 74.0 Weakly correlated
7 AluJr 1 n.s 74.0 Weakly correlated
8 AluSx 1 n.s 74.0 Weakly correlated
9 AluYj4 1 * 0.0 Weakly correlated
Motif in Repeats Consensus The motif of KZFPs identified by MEME-ChIP analysis can be utilized to locate the corresponding region within the consensus sequences of repeats. :
# Repeats name Emergence time(Mya) Time correlation with KZFP