ZRdb KZFP & Repeats
...

Human_ZNF599

  • Protein
    Zinc finger protein 599
  • Length
    588
  • Organism
    Homo sapiens (Human)
  • Time of emergence
    99.0 Mya
  • Time of Changing in binding specificity
    99.0 Mya
  • Uniprot_ID
    Q96NL3
  • NCBI_ID
    148103
Sequence:
MAAPALALVSFEDVVVTFTGEEWGHLDLAQRTLYQEVMLETCRLLVSLGHPVPKPELIYLLEHGQELWTVKRGLSQSTCAGEKAKPKITEPTASQLAFSEESSFQELLAQRSSRDSRLGQARDEEKLIKIQEGNLRPGTNPHKEICPEKLSYKHDDLEPDDSLGLRVLQERVTPQDALHECDSQGPGKDPMTDARNNPYTCTECGKGFSKKWALVRHQQIHAGVKPYECNECGKACRYMADVIRHMRLHTGEKPYKCIECGKAFKRRFHLTEHQRIHTGDKPYECKECGKAFTHRSSFIQHNMTHTREKPFLCKECGKAFYYSSSFAQHMRIHTGKKLYECGECGKAFTHRSTFIQHNVTHTGEKPFLCKECGKTFCLNSSFTQHMRIHTGEKPYECGECGKAFTHRSTFIRHKRTHTGEKPFECKECGKAFCDSSSLIQHMRIHTGEKPYECSECGKAFTHHSVFIRHNRTHSGQKPLECKECAKAFYYSSSFTRHMRIHTGEKPYVCRECGKAFTQPANFVRHNRIHTGEKPFECKECEKAFCDNFALTQHMRTHTGEKPFECNECGKTFSHSSSFTHHRKIHTRV
Domain KRAB, ZF, and degenerated ZF domains of KZFPs. :
...
# Domain name Pos
1 KRAB 9..80
2 C2h2 199..221
3 C2h2 227..249
4 C2h2 255..277
5 C2h2 283..305
6 C2h2 311..333
7 C2h2 339..361
8 C2h2 367..389
9 C2h2 395..417
10 C2h2 423..445
11 C2h2 451..473
12 C2h2 479..501
13 C2h2 507..529
14 C2h2 535..557
15 C2h2 563..585
Gene Ontology Annotation The Gene Ontology (GO) describes knowledge of the biological domain based on three aspects: Molecular function, Biological process, and Cellular component. :
# Type TERM
1 Cellular Component nucleus
2 Molecular Function DNA-binding transcription factor activity, RNA polymerase II-specific
3 Molecular Function DNA-binding transcription repressor activity, RNA polymerase II-specific
4 Molecular Function metal ion binding
5 Molecular Function RNA polymerase II transcription regulatory region sequence-specific DNA binding
6 Biological Process negative regulation of transcription by RNA polymerase II
7 Biological Process regulation of transcription by RNA polymerase II
Is there ChIP-seq data Is there any ChIP-seq data available for these KZFPs in the Cistrome database? :
Yes
Motif(meme-ChIP) DNA binding motifs of KZFPs obtained using meme-ChIP and mapped using pylogo. :
Forward:
...
Reverse:
...
Peak overlapping A ChIP-seq peak of KZFPs that intersects with a certain repeats sequences on the genome. :
# Repeats name Record number Significance Emergence time(Mya) Time correlation with KZFP
1 MER21B 6 **** 99.0 Highly correlated
2 LTR10A 4 **** 28.9 Weakly correlated
3 L1PA10 3 n.s 74.0 Weakly correlated
4 L1PA5 3 n.s 19.6 Weakly correlated
5 MLT1E3 2 *** 99.0 Highly correlated
6 MIRc 2 n.s 99.0 Highly correlated
7 MLT2B4 1 n.s 99.0 Highly correlated
8 AluJo 1 n.s 74.0 Weakly correlated
9 MLT1L 1 n.s 99.0 Highly correlated
10 MLT1A0 1 n.s 99.0 Highly correlated
11 MER54A 1 ** 87.0 Weakly correlated
12 LTR78B 1 * 99.0 Highly correlated
13 L2c 1 n.s 99.0 Highly correlated
14 L1MB8 1 n.s 99.0 Highly correlated
15 L1HS 1 n.s 8.6 Weakly correlated
16 AluY 1 n.s 74.0 Weakly correlated
17 AluSx3 1 n.s 74.0 Weakly correlated
18 AluJr 1 n.s 74.0 Weakly correlated
Motif in Repeats The motif of KZFPs identified by the MEME-ChIP is present in repeats sequences. :
# Repeats name Record number Significance Emergence time(Mya) Time correlation with KZFP
1 MER54A 1 ** 87.0 Weakly correlated
2 L1PA5 1 n.s 19.6 Weakly correlated
Motif in Repeats Consensus The motif of KZFPs identified by MEME-ChIP analysis can be utilized to locate the corresponding region within the consensus sequences of repeats. :
# Repeats name Emergence time(Mya) Time correlation with KZFP