ZRdb KZFP & Repeats
...

Human_ZNF595

  • Protein
    Zinc finger protein 595
  • Length
    648
  • Organism
    Homo sapiens (Human)
  • Time of emergence
    43.0 Mya
  • Time of Changing in binding specificity
    43.0 Mya
  • Uniprot_ID
    Q8IYB9
  • NCBI_ID
    152687
Sequence:
MELVTFRDVAIEFSPEEWKCLDPAQQNLYRDVMLENYRNLVSLGFVISNPDLVTCLEQIKEPCNLKIHETAAKPPAICSPFSQDLSPVQGIEDSFHKLILKRYEKCGHENLQLRKGCKRVNECKVQKGVNNGVYQCLSTTQSKIFQCNTCVKVFSKFSNSNKHKIRHTGEKPFKCTECGRSFYMSHLTQHTGIHAGEKPYKCEKCGKAFNRSTSLSKHKRIHTGEKPYTCEECGKAFRRSTVLNEHKKIHTGEKPYKCEECGKAFTRSTTLNEHKKIHTGEKPYKCKECGKAFRWSTSLNEHKNIHTGEKPYKCKECGKAFRQSRSLNEHKNIHTGEKPYTCEKCGKAFNQSSSLIIHRSIHSEQKLYKCEECGKAFTWSSSLNKHKRIHTGEKPYTCEECGKAFYRSSHLAKHKRIHTGEKPYTCEECGKAFNQSSTLILHKRIHSGQKPYKCEECGKAFTRSTTLNEHKKIHTGEKPYKCEECGKAFIWSASLNEHKNIHTGEKPYKCKECGKAFNQSSGLIIHRSIHSEQKLYKCEECGKAFTRSTALNEHKKIHSGEKPYKCKECGKAYNLSSTLTKHKRIHTGEKPFTCEECGKAFNWSSSLTKHKIIHTGEKSYKCEECGKAFNRPSTLTVHKRIHTGKEHS
Domain KRAB, ZF, and degenerated ZF domains of KZFPs. :
...
# Domain name Pos
1 KRAB 4..75
2 C2h2 145..167
3 C2h2 173..194
4 C2h2 200..222
5 C2h2 228..250
6 C2h2 256..278
7 C2h2 284..306
8 C2h2 312..334
9 C2h2 340..362
10 C2h2 368..390
11 C2h2 396..418
12 C2h2 424..446
13 C2h2 452..474
14 C2h2 480..502
15 C2h2 508..530
16 C2h2 536..558
17 C2h2 564..586
18 C2h2 592..614
19 C2h2 620..642
Gene Ontology Annotation The Gene Ontology (GO) describes knowledge of the biological domain based on three aspects: Molecular function, Biological process, and Cellular component. :
# Type TERM
1 Cellular Component nucleus
2 Molecular Function DNA-binding transcription factor activity, RNA polymerase II-specific
3 Molecular Function metal ion binding
4 Molecular Function RNA polymerase II cis-regulatory region sequence-specific DNA binding
5 Biological Process regulation of transcription by RNA polymerase II
Is there ChIP-seq data Is there any ChIP-seq data available for these KZFPs in the Cistrome database? :
Yes
Motif(meme-ChIP) DNA binding motifs of KZFPs obtained using meme-ChIP and mapped using pylogo. :
Forward:
...
Reverse:
...
Peak overlapping A ChIP-seq peak of KZFPs that intersects with a certain repeats sequences on the genome. :
# Repeats name Record number Significance Emergence time(Mya) Time correlation with KZFP
1 MER61-int 65 **** 43.0 Highly correlated
2 HUERS-P3b-int 16 **** 43.0 Highly correlated
3 LTR25-int 14 **** 43.0 Highly correlated
4 MER41-int 13 **** 74.0 Weakly correlated
5 MER57-int 13 **** 87.0 Weakly correlated
6 MIRb 5 n.s 99.0 Weakly correlated
7 AluSq2 4 n.s 74.0 Weakly correlated
8 AluSx1 3 n.s 74.0 Weakly correlated
9 LTR10A 3 **** 28.9 Weakly correlated
10 L3 3 * 99.0 Weakly correlated
11 LTR49-int 3 **** 74.0 Weakly correlated
12 L2a 3 n.s 99.0 Weakly correlated
13 MER4-int 3 **** 74.0 Weakly correlated
14 MLT1J2-int 2 **** 99.0 Weakly correlated
15 LTR12 2 **** 28.9 Weakly correlated
16 L2b 2 n.s 99.0 Weakly correlated
17 LTR76 2 **** 74.0 Weakly correlated
18 MER51-int 2 **** 43.0 Highly correlated
19 MER57A-int 2 *** 43.0 Highly correlated
20 MamRTE1 2 *** 99.0 Weakly correlated
21 MLT1L 2 ** 99.0 Weakly correlated
22 HAL1 2 n.s 99.0 Weakly correlated
23 MLT1B 2 * 99.0 Weakly correlated
24 MLT1D 2 n.s 99.0 Weakly correlated
25 MER52-int 1 ** 99.0 Weakly correlated
26 MER61B 1 *** 43.0 Highly correlated
27 MER68 1 ** 99.0 Weakly correlated
28 MIR 1 n.s 99.0 Weakly correlated
29 MLT1C 1 n.s 94.0 Weakly correlated
30 LTR37B 1 ** 99.0 Weakly correlated
31 LTR37-int 1 ** 99.0 Weakly correlated
32 MLT1H 1 * 99.0 Weakly correlated
33 L3b 1 * 99.0 Weakly correlated
34 L1MB8 1 n.s 99.0 Weakly correlated
35 AluSg 1 n.s 74.0 Weakly correlated
36 AluSp 1 n.s 74.0 Weakly correlated
37 AluSx 1 n.s 74.0 Weakly correlated
38 AluSz6 1 n.s 74.0 Weakly correlated
39 AluYj4 1 ** 0.0 Weakly correlated
40 ERVL-B4-int 1 * 99.0 Weakly correlated
41 FLAM_C 1 n.s 74.0 Weakly correlated
42 HAL1b 1 * 99.0 Weakly correlated
43 HERV35I-int 1 ** 43.0 Highly correlated
44 L1M1 1 n.s 74.0 Weakly correlated
45 L1MB5 1 n.s 99.0 Weakly correlated
46 LTR12_ 1 *** 28.9 Weakly correlated
47 L1MC1 1 n.s 99.0 Weakly correlated
48 L1MC2 1 n.s 99.0 Weakly correlated
49 L1MC5 1 n.s 99.0 Weakly correlated
50 L1MC5a 1 n.s 99.0 Weakly correlated
51 L1ME3C 1 ** 99.0 Weakly correlated
52 L1MEd 1 n.s 99.0 Weakly correlated
53 L2 1 n.s 99.0 Weakly correlated
54 L2c 1 n.s 99.0 Weakly correlated
55 AluJb 1 n.s 74.0 Weakly correlated
56 LFSINE_Vert 1 *** 319.0 Weakly correlated
Motif in Repeats The motif of KZFPs identified by the MEME-ChIP is present in repeats sequences. :
# Repeats name Record number Significance Emergence time(Mya) Time correlation with KZFP
1 MER61-int 65 **** 43.0 Highly correlated
2 HUERS-P3b-int 16 **** 43.0 Highly correlated
3 MER41-int 12 **** 74.0 Weakly correlated
4 LTR25-int 12 **** 43.0 Highly correlated
5 MER57-int 10 **** 87.0 Weakly correlated
6 LTR49-int 3 **** 74.0 Weakly correlated
7 MER51-int 2 **** 43.0 Highly correlated
8 MER57A-int 2 *** 43.0 Highly correlated
9 MER4-int 1 * 74.0 Weakly correlated
10 MLT1H 1 * 99.0 Weakly correlated
11 L2 1 n.s 99.0 Weakly correlated
12 HERV35I-int 1 ** 43.0 Highly correlated
Motif in Repeats Consensus The motif of KZFPs identified by MEME-ChIP analysis can be utilized to locate the corresponding region within the consensus sequences of repeats. :
# Repeats name Emergence time(Mya) Time correlation with KZFP
1 HUERS-P3B-INT 43.0 Highly correlated
2 LTR25-INT 43.0 Highly correlated
3 MER41-INT 74.0 Weakly correlated
4 MER57-INT 87.0 Weakly correlated
5 MER61-INT 43.0 Highly correlated