ZRdb KZFP & Repeats
...

Human_ZNF587B

  • Protein
    Zinc finger protein 587B
  • Length
    402
  • Organism
    Homo sapiens (Human)
  • Time of emergence
    28.9 Mya
  • Time of Changing in binding specificity
    8.6 Mya
  • Uniprot_ID
    E7ETH6
  • NCBI_ID
    100293516
Sequence:
MAVVATLRLSAQGTVTFEDVAVKFTQEEWNLLSEAQRCLYRDVTLENLALMSSLGCWCGVEDEAAPSKQSIYIQRETQVRTPVTGVSPKKAHPCEMCGPILGDILHVADHQGTHHKQKLHRCEAWGNKLYDSGNFHQHQNEHIGEKPYRGSVEEALFVKRCKLHVSGESSVFSESGKDFLPRSGLLQQEASHTGEKSNSKTECVSPFQCGGAHYSHGDSMKHFSTKHILSQHQRLLPREECYVCCECGKSFSKYVSFSNHQRVHSGKRPYECGECEKSFSQKSSLIQHQQFHTGGKPYGCEECGKYFSLEGYLRRHQKVHAGKGPYECGECGKSFSSNVNLKSHQRIHTGERPYKCGECEKSFSRKPSLSYHQRFGRPRWVDHKDRKEFKTSLGNIVKSCLF
Domain KRAB, ZF, and degenerated ZF domains of KZFPs. :
...
# Domain name Pos
1 KRAB 15..91
2 C2h2 92..114
3 dec2h2 120..142
4 C2h2 242..264
5 C2h2 270..292
6 C2h2 298..320
7 C2h2 326..348
8 C2h2 354..383
Gene Ontology Annotation The Gene Ontology (GO) describes knowledge of the biological domain based on three aspects: Molecular function, Biological process, and Cellular component. :
# Type TERM
1 Cellular Component nucleus
2 Molecular Function DNA-binding transcription factor activity, RNA polymerase II-specific
3 Molecular Function DNA-binding transcription repressor activity, RNA polymerase II-specific
4 Molecular Function metal ion binding
5 Molecular Function RNA polymerase II transcription regulatory region sequence-specific DNA binding
6 Biological Process negative regulation of transcription by RNA polymerase II
7 Biological Process regulation of transcription by RNA polymerase II
Is there ChIP-seq data Is there any ChIP-seq data available for these KZFPs in the Cistrome database? :
Yes
Motif(meme-ChIP) DNA binding motifs of KZFPs obtained using meme-ChIP and mapped using pylogo. :
Forward:
...
Reverse:
...
Peak overlapping A ChIP-seq peak of KZFPs that intersects with a certain repeats sequences on the genome. :
# Repeats name Record number Significance Emergence time(Mya) Time correlation with KZFP
1 MER21B 5 **** 99.0 Weakly correlated
2 LTR10A 4 **** 28.9 Weakly correlated
3 SVA_D 3 ** 15.2 Moderately correlated
4 AluY 3 n.s 74.0 Weakly correlated
5 AluJr 2 n.s 74.0 Weakly correlated
6 MIRc 2 n.s 99.0 Weakly correlated
7 L1PA5 2 n.s 19.6 Moderately correlated
8 L1PA10 2 n.s 74.0 Weakly correlated
9 L1MB8 2 n.s 99.0 Weakly correlated
10 AluJb 2 n.s 74.0 Weakly correlated
11 LTR12C 1 n.s 19.6 Moderately correlated
12 SVA_E 1 ** 0.0 Weakly correlated
13 MSTB2 1 ** 74.0 Weakly correlated
14 MLT1L 1 n.s 99.0 Weakly correlated
15 MLT1E3 1 * 99.0 Weakly correlated
16 AluSx1 1 n.s 74.0 Weakly correlated
17 MER52D 1 * 74.0 Weakly correlated
18 AluYa5 1 * 15.2 Moderately correlated
19 L1MA8 1 n.s 87.0 Weakly correlated
20 LTR10B1 1 *** 28.9 Weakly correlated
21 ERVL-int 1 ** 99.0 Weakly correlated
22 L1HS 1 n.s 8.6 Highly correlated
23 L1PA13 1 n.s 74.0 Weakly correlated
24 L1M1 1 n.s 74.0 Weakly correlated
25 L1P4 1 n.s 74.0 Weakly correlated
26 L1MC4 1 n.s 99.0 Weakly correlated
27 L1MA2 1 n.s 74.0 Weakly correlated
Motif in Repeats The motif of KZFPs identified by the MEME-ChIP is present in repeats sequences. :
# Repeats name Record number Significance Emergence time(Mya) Time correlation with KZFP
Motif in Repeats Consensus The motif of KZFPs identified by MEME-ChIP analysis can be utilized to locate the corresponding region within the consensus sequences of repeats. :
# Repeats name Emergence time(Mya) Time correlation with KZFP