ZRdb KZFP & Repeats
...

Human_ZNF569

  • Protein
    Zinc finger protein 569
  • Length
    686
  • Organism
    Homo sapiens (Human)
  • Time of emergence
    99.0 Mya
  • Time of Changing in binding specificity
    99.0 Mya
  • Uniprot_ID
    Q5MCW4
  • NCBI_ID
    148266
Sequence:
MTESQGTVTFKDVAIDFTQEEWKRLDPAQRKLYRNVMLENYNNLITVGYPFTKPDVIFKLEQEEEPWVMEEEVLRRHWQGEIWGVDEHQKNQDRLLRQVEVKFQKTLTEEKGNECQKKFANVFPLNSDFFPSRHNLYEYDLFGKCLEHNFDCHNNVKCLMRKEHCEYNEPVKSYGNSSSHFVITPFKCNHCGKGFNQTLDLIRHLRIHTGEKPYECSNCRKAFSHKEKLIKHYKIHSREQSYKCNECGKAFIKMSNLIRHQRIHTGEKPYACKECEKSFSQKSNLIDHEKIHTGEKPYECNECGKAFSQKQSLIAHQKVHTGEKPYACNECGKAFPRIASLALHMRSHTGEKPYKCDKCGKAFSQFSMLIIHVRIHTGEKPYECNECGKAFSQSSALTVHMRSHTGEKPYECKECRKAFSHKKNFITHQKIHTREKPYECNECGKAFIQMSNLVRHQRIHTGEKPYICKECGKAFSQKSNLIAHEKIHSGEKPYECNECGKAFSQKQNFITHQKVHTGEKPYDCNECGKAFSQIASLTLHLRSHTGEKPYECDKCGKAFSQCSLLNLHMRSHTGEKPYVCNECGKAFSQRTSLIVHMRGHTGEKPYECNKCGKAFSQSSSLTIHIRGHTGEKPFDCSKCGKAFSQISSLTLHMRKHTGEKPYHCIECGKAFSQKSHLVRHQRIHTH
Domain KRAB, ZF, and degenerated ZF domains of KZFPs. :
...
# Domain name Pos
1 KRAB 8..79
2 C2h2 186..208
3 C2h2 214..236
4 C2h2 242..264
5 C2h2 270..292
6 C2h2 298..320
7 C2h2 326..348
8 C2h2 354..376
9 C2h2 382..404
10 C2h2 410..432
11 C2h2 438..460
12 C2h2 466..488
13 C2h2 494..516
14 C2h2 522..544
15 C2h2 550..572
16 C2h2 578..600
17 C2h2 606..628
18 C2h2 634..656
19 C2h2 662..684
Gene Ontology Annotation The Gene Ontology (GO) describes knowledge of the biological domain based on three aspects: Molecular function, Biological process, and Cellular component. :
# Type TERM
1 Cellular Component nucleus
2 Molecular Function DNA-binding transcription factor activity, RNA polymerase II-specific
3 Molecular Function metal ion binding
4 Molecular Function RNA polymerase II cis-regulatory region sequence-specific DNA binding
5 Biological Process regulation of transcription by RNA polymerase II
Is there ChIP-seq data Is there any ChIP-seq data available for these KZFPs in the Cistrome database? :
Yes
Motif(meme-ChIP) DNA binding motifs of KZFPs obtained using meme-ChIP and mapped using pylogo. :
Forward:
...
Reverse:
...
Peak overlapping A ChIP-seq peak of KZFPs that intersects with a certain repeats sequences on the genome. :
# Repeats name Record number Significance Emergence time(Mya) Time correlation with KZFP
1 L1M7 21 **** 99.0 Highly correlated
2 L1P3 10 **** 74.0 Weakly correlated
3 AluSc8 8 *** 74.0 Weakly correlated
4 AluYm1 6 **** 19.6 Weakly correlated
5 AluY 5 n.s 74.0 Weakly correlated
6 LTR10A 4 **** 28.9 Weakly correlated
7 HAL1ME 4 ** 99.0 Highly correlated
8 AluYj4 4 **** 0.0 Weakly correlated
9 L1PA2 3 n.s 15.2 Weakly correlated
10 MER21B 3 ** 99.0 Highly correlated
11 L1M5 3 n.s 99.0 Highly correlated
12 L1M4 3 n.s 99.0 Highly correlated
13 MER51B 3 **** 43.0 Weakly correlated
14 FRAM 3 *** 74.0 Weakly correlated
15 L1MEd 2 n.s 99.0 Highly correlated
16 L2a 2 n.s 99.0 Highly correlated
17 AluSx3 2 n.s 74.0 Weakly correlated
18 AluSx 2 n.s 74.0 Weakly correlated
19 AluSq2 2 n.s 74.0 Weakly correlated
20 L1M6 2 * 99.0 Highly correlated
21 AluJr 2 n.s 74.0 Weakly correlated
22 AluJb 2 n.s 74.0 Weakly correlated
23 LTR10F 2 **** 28.9 Weakly correlated
24 L1PA6 1 n.s 28.9 Weakly correlated
25 L1PA7 1 n.s 74.0 Weakly correlated
26 L1PA4 1 n.s 19.6 Weakly correlated
27 MER21C 1 n.s 99.0 Highly correlated
28 LTR10B1 1 *** 28.9 Weakly correlated
29 LTR13 1 * 19.6 Weakly correlated
30 LTR37B 1 * 99.0 Highly correlated
31 LTR85a 1 ** 99.0 Highly correlated
32 L1ME3Cz 1 n.s 99.0 Highly correlated
33 MER67D 1 ** 99.0 Highly correlated
34 MIR 1 n.s 99.0 Highly correlated
35 MLT1A0 1 n.s 99.0 Highly correlated
36 MLT1F1 1 n.s 99.0 Highly correlated
37 MLT1L 1 n.s 99.0 Highly correlated
38 SVA_D 1 n.s 15.2 Weakly correlated
39 SVA_F 1 * 0.0 Weakly correlated
40 L1MB8 1 n.s 99.0 Highly correlated
41 AluJo 1 n.s 74.0 Weakly correlated
42 AluSp 1 n.s 74.0 Weakly correlated
43 AluSx1 1 n.s 74.0 Weakly correlated
44 AluYa8 1 *** 15.2 Weakly correlated
45 AluYi6 1 *** 15.2 Weakly correlated
46 HERV17-int 1 * 28.9 Weakly correlated
47 L1HS 1 n.s 8.6 Weakly correlated
48 L1M 1 *** 74.0 Weakly correlated
49 L1M3 1 n.s 99.0 Highly correlated
50 L1MB4 1 n.s 99.0 Highly correlated
51 L1PA14 1 n.s 74.0 Weakly correlated
52 L1MC1 1 n.s 99.0 Highly correlated
53 L1MC4 1 n.s 99.0 Highly correlated
54 L1ME1 1 n.s 99.0 Highly correlated
55 L1ME3 1 n.s 99.0 Highly correlated
56 L1ME3E 1 n.s 99.0 Highly correlated
57 L1ME3G 1 n.s 99.0 Highly correlated
58 L1ME4b 1 n.s 99.0 Highly correlated
59 L1MEf 1 n.s 99.0 Highly correlated
60 L1P4 1 n.s 74.0 Weakly correlated
Motif in Repeats The motif of KZFPs identified by the MEME-ChIP is present in repeats sequences. :
# Repeats name Record number Significance Emergence time(Mya) Time correlation with KZFP
1 AluY 1 n.s 74.0 Weakly correlated
2 AluYj4 1 * 0.0 Weakly correlated
3 L1PA14 1 n.s 74.0 Weakly correlated
Motif in Repeats Consensus The motif of KZFPs identified by MEME-ChIP analysis can be utilized to locate the corresponding region within the consensus sequences of repeats. :
# Repeats name Emergence time(Mya) Time correlation with KZFP