ZRdb KZFP & Repeats
...

Human_ZNF552

  • Protein
    Zinc finger protein 552
  • Length
    407
  • Organism
    Homo sapiens (Human)
  • Time of emergence
    94.0 Mya
  • Time of Changing in binding specificity
    28.9 Mya
  • Uniprot_ID
    Q9H707
  • NCBI_ID
    79818
Sequence:
MAAAALRFPVQGTVTFEDVAVKFTQEEWNLLSEAQRCLYRDVTLENLALMSSLGCWCGVEDEAAPSKQSIYIQRETQVRTPMAGVSPKKAHPCEMCGPILGDILHVADHQGTHHKQKLHRCEAWGNKLYDSGNFHQHQNEHIGEKPYRGSVEEALFAKRCKLHVSGESSVFSESGKDFLLRSGLLQQEATHTGKSNSKTECVSLFHGGKSHYSCGGCMKHFSTKDILSQHERLLPTEEPSVWCECGKSSSKYDSFSNHQGVHTREKPYTCGICGKLFNSKSHLLVHQRIHTGEKPYECEVCQKFFRHKYHLIAHQRVHTGERPYECSDCGKSFTHSSTFRVHKRVHTGQKPYECSECGKSFAESSSLTKHRRVHTGEKPYGCSECEKKFRQISSLRHHQRVHKRKGL
Domain KRAB, ZF, and degenerated ZF domains of KZFPs. :
...
# Domain name Pos
1 KRAB 14..90
2 C2h2 91..113
3 dec2h2 119..141
4 dec2h2 212..234
5 dec2h2 244..262
6 C2h2 268..290
7 C2h2 296..318
8 C2h2 324..346
9 C2h2 352..374
10 C2h2 380..402
Gene Ontology Annotation The Gene Ontology (GO) describes knowledge of the biological domain based on three aspects: Molecular function, Biological process, and Cellular component. :
# Type TERM
1 Cellular Component nucleus
2 Molecular Function DNA-binding transcription factor activity, RNA polymerase II-specific
3 Molecular Function metal ion binding
4 Molecular Function RNA polymerase II cis-regulatory region sequence-specific DNA binding
5 Biological Process regulation of transcription by RNA polymerase II
Is there ChIP-seq data Is there any ChIP-seq data available for these KZFPs in the Cistrome database? :
Yes
Motif(meme-ChIP) DNA binding motifs of KZFPs obtained using meme-ChIP and mapped using pylogo. :
Forward:
...
Reverse:
...
Peak overlapping A ChIP-seq peak of KZFPs that intersects with a certain repeats sequences on the genome. :
# Repeats name Record number Significance Emergence time(Mya) Time correlation with KZFP
1 L1P3 4 **** 74.0 Weakly correlated
2 LTR10A 3 **** 28.9 Highly correlated
3 MIRc 2 n.s 99.0 Weakly correlated
4 L1PA5 2 n.s 19.6 Weakly correlated
5 LTR14B 2 **** 28.9 Highly correlated
6 MSTA-int 1 * 43.0 Moderately correlated
7 AluSz6 1 n.s 74.0 Weakly correlated
8 MLT1D 1 n.s 99.0 Weakly correlated
9 MLT1A1 1 * 87.0 Weakly correlated
10 MER49 1 ** 43.0 Moderately correlated
11 MER39B 1 ** 74.0 Weakly correlated
12 LTR13 1 ** 19.6 Weakly correlated
13 LTR12D 1 *** 19.6 Weakly correlated
14 L1P4 1 * 74.0 Weakly correlated
15 L1P1 1 * 19.6 Weakly correlated
16 L1ME4b 1 n.s 99.0 Weakly correlated
17 L1ME3A 1 n.s 99.0 Weakly correlated
18 AluYm1 1 * 19.6 Weakly correlated
19 AluY 1 n.s 74.0 Weakly correlated
Motif in Repeats The motif of KZFPs identified by the MEME-ChIP is present in repeats sequences. :
# Repeats name Record number Significance Emergence time(Mya) Time correlation with KZFP
1 AluSz6 1 n.s 74.0 Weakly correlated
Motif in Repeats Consensus The motif of KZFPs identified by MEME-ChIP analysis can be utilized to locate the corresponding region within the consensus sequences of repeats. :
# Repeats name Emergence time(Mya) Time correlation with KZFP