ZRdb KZFP & Repeats
...

Human_ZNF461

  • Protein
    Zinc finger protein 461
  • Length
    563
  • Organism
    Homo sapiens (Human)
  • Time of emergence
    99.0 Mya
  • Time of Changing in binding specificity
    99.0 Mya
  • Uniprot_ID
    Q8TAF7
  • NCBI_ID
    92283
Sequence:
MAHELVMFRDVAIDVSQEEWECLNPAQRNLYKEVMLENYSNLVSLGLSVSKPAVISSLEQGKEPWMVVREETGRWCPGTWKTWGFHNNFLDNNEATDINADLASRDEPQKLSPKRDIYETELSQWVNMEEFKSHSPERSIFSAIWEGNCHFEQHQGQEEGYFRQLMINHENMPIFSQHTLLTQEFYDREKISECKKCRKIFSYHLFFSHHKRTHSKELSECKECTEIVNTPCLFKQQTIQNGDKCNECKECWKAFVHCSQLKHLRIHNGEKRYECNECGKAFNYGSELTLHQRIHTGEKPYECKECGKAFRQRSQLTQHQRLHTGEKPYECKQCGKAFIRGFQLTEHLRLHTGEKPYECKECGKTFRHRSHLTIHQRIHTGEKPYECRECGKAFSYHSSFSHHQKIHSGKKPYECHECGKAFCDGLQLTLHQRIHTGEKPYECKECGKTFRQCSHLKRHQRIHTGEKPHECMICGKAFRLHSHLIQHQRIHTGEKPYECKECGKAFSYHSSFSHHQRIHSGKKPYQCGKAFNHRLQLNLHQTLHTGEKPVRFPLLPPHPSLAS
Domain KRAB, ZF, and degenerated ZF domains of KZFPs. :
...
# Domain name Pos
1 KRAB 6..77
2 C2h2 192..214
3 C2h2 246..267
4 C2h2 273..295
5 C2h2 301..323
6 C2h2 329..351
7 C2h2 357..379
8 C2h2 385..407
9 C2h2 413..435
10 C2h2 441..463
11 C2h2 469..491
12 C2h2 497..519
13 dec2h2 522..544
Gene Ontology Annotation The Gene Ontology (GO) describes knowledge of the biological domain based on three aspects: Molecular function, Biological process, and Cellular component. :
# Type TERM
1 Cellular Component nucleus
2 Molecular Function DNA-binding transcription factor activity, RNA polymerase II-specific
3 Molecular Function metal ion binding
4 Molecular Function RNA polymerase II cis-regulatory region sequence-specific DNA binding
5 Biological Process regulation of transcription by RNA polymerase II
Is there ChIP-seq data Is there any ChIP-seq data available for these KZFPs in the Cistrome database? :
Yes
Motif(meme-ChIP) DNA binding motifs of KZFPs obtained using meme-ChIP and mapped using pylogo. :
Forward:
...
Reverse:
...
Peak overlapping A ChIP-seq peak of KZFPs that intersects with a certain repeats sequences on the genome. :
# Repeats name Record number Significance Emergence time(Mya) Time correlation with KZFP
1 SVA_F 202 **** 0.0 Weakly correlated
2 SVA_D 160 **** 15.2 Weakly correlated
3 SVA_E 59 **** 0.0 Weakly correlated
4 AluYb8 46 **** 15.2 Weakly correlated
5 LTR12C 43 **** 19.6 Weakly correlated
6 AluYa5 41 **** 15.2 Weakly correlated
7 AluY 33 *** 74.0 Weakly correlated
8 LTR16 17 **** 99.0 Highly correlated
9 SVA_C 16 **** 15.2 Weakly correlated
10 SVA_B 10 **** 15.2 Weakly correlated
11 AluSc8 9 ** 74.0 Weakly correlated
12 SVA_A 9 **** 19.6 Weakly correlated
13 AluYb9 8 **** 15.2 Weakly correlated
14 L1P3 7 *** 74.0 Weakly correlated
15 AluSz 6 n.s 74.0 Weakly correlated
16 LTR8 6 **** 43.0 Weakly correlated
17 AluYm1 6 **** 19.6 Weakly correlated
18 AluYg6 5 **** 15.2 Weakly correlated
19 LTR12D 5 **** 19.6 Weakly correlated
20 LTR10A 4 **** 28.9 Weakly correlated
21 AluJb 4 n.s 74.0 Weakly correlated
22 LTR16A 3 ** 99.0 Highly correlated
23 MIRb 3 n.s 99.0 Highly correlated
24 MLT1N2 3 ** 99.0 Highly correlated
25 L2b 3 n.s 99.0 Highly correlated
26 LTR1C3 3 **** 43.0 Weakly correlated
27 AluSp 3 n.s 74.0 Weakly correlated
28 FRAM 2 * 74.0 Weakly correlated
29 MLT2C1 2 ** 99.0 Highly correlated
30 AluYj4 2 ** 0.0 Weakly correlated
31 AluYi6 2 **** 15.2 Weakly correlated
32 AluYh3 2 ** 15.2 Weakly correlated
33 AluYe5 2 ** 74.0 Weakly correlated
34 AluYd8 2 **** 15.2 Weakly correlated
35 AluYc 2 * 74.0 Weakly correlated
36 AluSc 2 n.s 74.0 Weakly correlated
37 L1PA2 2 n.s 15.2 Weakly correlated
38 MER21B 2 * 99.0 Highly correlated
39 L2a 2 n.s 99.0 Highly correlated
40 LTR67B 1 n.s 99.0 Highly correlated
41 MSTA 1 n.s 43.0 Weakly correlated
42 MIR 1 n.s 99.0 Highly correlated
43 MIR3 1 n.s 99.0 Highly correlated
44 MIRc 1 n.s 99.0 Highly correlated
45 MLT1B 1 n.s 99.0 Highly correlated
46 MLT1F1 1 n.s 99.0 Highly correlated
47 MLT1L 1 n.s 99.0 Highly correlated
48 L1P4 1 n.s 74.0 Weakly correlated
49 MamRep1527 1 * 99.0 Highly correlated
50 THE1C 1 n.s 43.0 Weakly correlated
51 L1M3 1 n.s 99.0 Highly correlated
52 AluJo 1 n.s 74.0 Weakly correlated
53 AluJr 1 n.s 74.0 Weakly correlated
54 AluSx 1 n.s 74.0 Weakly correlated
55 AluSx1 1 n.s 74.0 Weakly correlated
56 AluSx3 1 n.s 74.0 Weakly correlated
57 AluYa8 1 *** 15.2 Weakly correlated
58 AluYh7 1 **** 0.0 Weakly correlated
59 ERV3-16A3_I-int 1 n.s 99.0 Highly correlated
60 FLAM_C 1 n.s 74.0 Weakly correlated
61 L1HS 1 n.s 8.6 Weakly correlated
62 LTR13 1 * 19.6 Weakly correlated
63 L1MA6 1 n.s 87.0 Weakly correlated
64 L1MA9 1 n.s 99.0 Highly correlated
65 L1MB8 1 n.s 99.0 Highly correlated
66 L1MC4 1 n.s 99.0 Highly correlated
67 L1ME3Cz 1 n.s 99.0 Highly correlated
68 L1MEd 1 n.s 99.0 Highly correlated
69 L1PA5 1 n.s 19.6 Weakly correlated
70 L1PB3 1 n.s 74.0 Weakly correlated
71 L2c 1 n.s 99.0 Highly correlated
72 LTR10B1 1 *** 28.9 Weakly correlated
Motif in Repeats The motif of KZFPs identified by the MEME-ChIP is present in repeats sequences. :
# Repeats name Record number Significance Emergence time(Mya) Time correlation with KZFP
1 SVA_F 184 **** 0.0 Weakly correlated
2 SVA_D 161 **** 15.2 Weakly correlated
3 SVA_E 53 **** 0.0 Weakly correlated
4 AluYb8 42 **** 15.2 Weakly correlated
5 AluYa5 41 **** 15.2 Weakly correlated
6 AluY 29 ** 74.0 Weakly correlated
7 SVA_C 16 **** 15.2 Weakly correlated
8 SVA_B 10 **** 15.2 Weakly correlated
9 SVA_A 8 **** 19.6 Weakly correlated
10 AluYb9 8 **** 15.2 Weakly correlated
11 AluYg6 5 **** 15.2 Weakly correlated
12 AluYd8 2 **** 15.2 Weakly correlated
13 AluYm1 2 * 19.6 Weakly correlated
14 AluYh3 2 ** 15.2 Weakly correlated
15 AluYe5 2 ** 74.0 Weakly correlated
16 AluYc 2 * 74.0 Weakly correlated
17 LTR12C 1 n.s 19.6 Weakly correlated
18 AluSp 1 n.s 74.0 Weakly correlated
19 AluSc 1 n.s 74.0 Weakly correlated
20 AluYh7 1 **** 0.0 Weakly correlated
21 AluSc8 1 n.s 74.0 Weakly correlated
22 AluSx3 1 n.s 74.0 Weakly correlated
23 AluYj4 1 n.s 0.0 Weakly correlated
Motif in Repeats Consensus The motif of KZFPs identified by MEME-ChIP analysis can be utilized to locate the corresponding region within the consensus sequences of repeats. :
# Repeats name Emergence time(Mya) Time correlation with KZFP
1 ALUY 74.0 Weakly correlated
2 ALUYA5 15.2 Weakly correlated
3 ALUYB8 15.2 Weakly correlated
4 ALUYB9 15.2 Weakly correlated