ZRdb KZFP & Repeats
...

Human_ZNF431

  • Protein
    Zinc finger protein 431
  • Length
    576
  • Organism
    Homo sapiens (Human)
  • Time of emergence
    28.9 Mya
  • Time of Changing in binding specificity
    28.9 Mya
  • Uniprot_ID
    Q8TF32
  • NCBI_ID
    170959
Sequence:
MDDLKYGVYPLKEASGCPGAERNLLVYSYFEKETLTFRDVAIEFSLEEWECLNPAQQNLYMNVMLENYKNLVFLGVAVSKQDPVTCLEQEKEPWNMKRHEMVDEPPAMCSYFTKDLWPEQDIKDSFQQVILRRYGKCEHENLQLRKGSASVDEYKVHKEGYNELNQCLTTTQSKIFPCDKYVKVFHKFLNANRHKTRHTGKKPFKCKKCGKSFCMLLHLSQHKRIHIRENSYQCEECGKAFKWFSTLTRHKRIHTGEKPFKCEECGKAFKQSSTLTTHKIIHTGEKPYRCEECGKAFNRSSHLTTHKIIHTGEKPYKCEECGKAFNQSSTLSTHKFIHAGEKPYKCEECDKAFNRFSYLTKHKIIHTGEKSYKCEECGKGFNWSSTLTKHKRIHTGEKPYKCEVCGKAFNESSNLTTHKMIHTGEKPYKCEECGKAFNRSPQLTAHKIIHTGEKPYKCEECGKAFSQSSILTTHKRIHTGEKPYKCEECGKAFNRSSNLTKHKIIHTGEKSYKCEECGKAFNQSSTLTKHRKIHTRQKPYNCEECDNTFNQSSNLIKQNNSYWRETLQMSRMWESL
Domain KRAB, ZF, and degenerated ZF domains of KZFPs. :
...
# Domain name Pos
1 KRAB 35..106
2 dec2h2 176..198
3 C2h2 204..226
4 C2h2 232..254
5 C2h2 260..282
6 C2h2 288..310
7 C2h2 316..338
8 C2h2 344..366
9 C2h2 372..394
10 C2h2 400..422
11 C2h2 428..450
12 C2h2 456..478
13 C2h2 484..506
14 C2h2 512..534
Gene Ontology Annotation The Gene Ontology (GO) describes knowledge of the biological domain based on three aspects: Molecular function, Biological process, and Cellular component. :
# Type TERM
1 Cellular Component nucleus
2 Molecular Function chromatin binding
3 Molecular Function DNA-binding transcription factor activity, RNA polymerase II-specific
4 Molecular Function metal ion binding
5 Molecular Function RNA polymerase II cis-regulatory region sequence-specific DNA binding
6 Biological Process cell differentiation
7 Biological Process negative regulation of DNA-binding transcription factor activity
8 Biological Process negative regulation of transcription by RNA polymerase II
9 Biological Process regulation of DNA-templated transcription
Is there ChIP-seq data Is there any ChIP-seq data available for these KZFPs in the Cistrome database? :
Yes
Motif(meme-ChIP) DNA binding motifs of KZFPs obtained using meme-ChIP and mapped using pylogo. :
Forward:
...
Reverse:
...
Peak overlapping A ChIP-seq peak of KZFPs that intersects with a certain repeats sequences on the genome. :
# Repeats name Record number Significance Emergence time(Mya) Time correlation with KZFP
1 LTR33B 17 **** 99.0 Weakly correlated
2 LTR8 6 **** 43.0 Moderately correlated
3 L2a 6 n.s 99.0 Weakly correlated
4 THE1B 5 ** 43.0 Moderately correlated
5 MLT1C 5 ** 94.0 Weakly correlated
6 LTR10A 4 **** 28.9 Highly correlated
7 L2b 3 n.s 99.0 Weakly correlated
8 AluY 3 n.s 74.0 Weakly correlated
9 L2 3 n.s 99.0 Weakly correlated
10 MIRb 3 n.s 99.0 Weakly correlated
11 MIR3 3 n.s 99.0 Weakly correlated
12 LTR50 2 *** 99.0 Weakly correlated
13 LTR2C 2 **** 19.6 Weakly correlated
14 LTR10F 2 **** 28.9 Highly correlated
15 L1PA5 2 n.s 19.6 Weakly correlated
16 L1PA2 2 n.s 15.2 Weakly correlated
17 MSTA 2 n.s 43.0 Moderately correlated
18 AluSg 2 n.s 74.0 Weakly correlated
19 AluSp 2 n.s 74.0 Weakly correlated
20 MLT1A 2 * 99.0 Weakly correlated
21 MLT1B 2 n.s 99.0 Weakly correlated
22 MIR 2 n.s 99.0 Weakly correlated
23 MER50 1 * 43.0 Moderately correlated
24 LTR14B 1 *** 28.9 Highly correlated
25 LTR8B 1 ** 43.0 Moderately correlated
26 MER110A 1 *** 99.0 Weakly correlated
27 MER21C 1 n.s 99.0 Weakly correlated
28 MLT1K 1 n.s 99.0 Weakly correlated
29 MLT1F 1 * 99.0 Weakly correlated
30 MER39B 1 ** 74.0 Weakly correlated
31 MLT1A1 1 n.s 87.0 Weakly correlated
32 MLT1A0 1 n.s 99.0 Weakly correlated
33 MER50-int 1 ** 43.0 Moderately correlated
34 MER61C 1 *** 43.0 Moderately correlated
35 MIRc 1 n.s 99.0 Weakly correlated
36 MER65C 1 *** 74.0 Weakly correlated
37 MER66B 1 ** 43.0 Moderately correlated
38 HAL1b 1 * 99.0 Weakly correlated
39 AluJr 1 n.s 74.0 Weakly correlated
40 AluSc8 1 n.s 74.0 Weakly correlated
41 AluSx 1 n.s 74.0 Weakly correlated
42 AluSx1 1 n.s 74.0 Weakly correlated
43 AluSx3 1 n.s 74.0 Weakly correlated
44 AluSz 1 n.s 74.0 Weakly correlated
45 AluSz6 1 n.s 74.0 Weakly correlated
46 AluYm1 1 * 19.6 Weakly correlated
47 FLAM_C 1 n.s 74.0 Weakly correlated
48 FRAM 1 * 74.0 Weakly correlated
49 HAL1 1 n.s 99.0 Weakly correlated
50 LTR41B 1 ** 99.0 Weakly correlated
51 HERVE_a-int 1 ** 28.9 Highly correlated
52 L1ME4a 1 n.s 99.0 Weakly correlated
53 L1P1 1 n.s 19.6 Weakly correlated
54 L1PA4 1 n.s 19.6 Weakly correlated
55 L1PA8 1 n.s 74.0 Weakly correlated
56 L2c 1 n.s 99.0 Weakly correlated
57 L3 1 n.s 99.0 Weakly correlated
58 AluJb 1 n.s 74.0 Weakly correlated
59 LTR16D1 1 **** 99.0 Weakly correlated
60 LTR2 1 ** 28.9 Highly correlated
Motif in Repeats The motif of KZFPs identified by the MEME-ChIP is present in repeats sequences. :
# Repeats name Record number Significance Emergence time(Mya) Time correlation with KZFP
1 LTR33B 1 ** 99.0 Weakly correlated
Motif in Repeats Consensus The motif of KZFPs identified by MEME-ChIP analysis can be utilized to locate the corresponding region within the consensus sequences of repeats. :
# Repeats name Emergence time(Mya) Time correlation with KZFP