ZRdb KZFP & Repeats
...

Human_ZNF426

  • Protein
    Zinc finger protein 426
  • Length
    554
  • Organism
    Homo sapiens (Human)
  • Time of emergence
    87.0 Mya
  • Time of Changing in binding specificity
    87.0 Mya
  • Uniprot_ID
    Q9BUY5
  • NCBI_ID
    79088
Sequence:
MAAADLSHGHYLSGDPVCLHEEKTPAGRIVADCLTDCYQDSVTFDDVAVDFTQEEWTLLDSTQRSLYSDVMLENYKNLATVGGQIIKPSLISWLEQEESRTVQGGVLQGWEMRLETQWSILQQDFLRGQTSIGIQLEGKHNGRELCDCEQCGEVFSEHSCLKTHVRTQSTGNTHDCNQYGKDFLTLCEKTSTGEKLSEFNQSEKIFSLTPNIVYQRTSTQEKSFECSHCGKSFINESYLQAHMRTHNGEKLYEWRNYGPGFIDSTSLSVLIETLNAKKPYKCKECGKGYRYPAYLSIHMRTHTGEKPYECKECGKAFNYSNSFQIHGRTHTGEKPYVCKECGKAFTQYSGLSMHVRSHSGDKPYECKECGKSFLTSSRLIQHIRTHTGEKPFVCVECGKAFAVSSNLSGHLRTHTEEKACECKICGKVFGYPSCLNNHMRTHSAQKPYTCKECGKAFNYSTHLKIHMRIHTGEKPYECKQCGKAFSHSSSFQIHERTHTGEKPYECKECGKAFTCSSSFRIHEKTHTEEKPYKCQQCGKAYSHPRSLRRHEQIH
Domain KRAB, ZF, and degenerated ZF domains of KZFPs. :
...
# Domain name Pos
1 KRAB 42..112
2 C2h2 146..174
3 C2h2 224..246
4 C2h2 280..302
5 C2h2 308..330
6 C2h2 336..358
7 C2h2 364..386
8 C2h2 392..414
9 C2h2 420..442
10 C2h2 448..470
11 C2h2 476..498
12 C2h2 504..526
13 C2h2 532..554
Gene Ontology Annotation The Gene Ontology (GO) describes knowledge of the biological domain based on three aspects: Molecular function, Biological process, and Cellular component. :
# Type TERM
1 Cellular Component nucleus
2 Molecular Function DNA-binding transcription factor activity, RNA polymerase II-specific
3 Molecular Function metal ion binding
4 Molecular Function RNA polymerase II cis-regulatory region sequence-specific DNA binding
5 Biological Process regulation of transcription by RNA polymerase II
Is there ChIP-seq data Is there any ChIP-seq data available for these KZFPs in the Cistrome database? :
Yes
Motif(meme-ChIP) DNA binding motifs of KZFPs obtained using meme-ChIP and mapped using pylogo. :
Forward:
...
Reverse:
...
Peak overlapping A ChIP-seq peak of KZFPs that intersects with a certain repeats sequences on the genome. :
# Repeats name Record number Significance Emergence time(Mya) Time correlation with KZFP
1 L1P3 9 **** 74.0 Weakly correlated
2 AluSc8 7 *** 74.0 Weakly correlated
3 AluYj4 4 **** 0.0 Weakly correlated
4 LTR10A 4 **** 28.9 Weakly correlated
5 MER21B 3 *** 99.0 Moderately correlated
6 LTR10F 3 **** 28.9 Weakly correlated
7 THE1C 1 n.s 43.0 Weakly correlated
8 AluJo 1 n.s 74.0 Weakly correlated
9 SVA_F 1 * 0.0 Weakly correlated
10 MLT1L 1 n.s 99.0 Moderately correlated
11 MIR3 1 n.s 99.0 Moderately correlated
12 MER21C 1 n.s 99.0 Moderately correlated
13 LTR13 1 ** 19.6 Weakly correlated
14 L2b 1 n.s 99.0 Moderately correlated
15 L1PA5 1 n.s 19.6 Weakly correlated
16 L1PA4 1 n.s 19.6 Weakly correlated
17 L1P4 1 n.s 74.0 Weakly correlated
18 L1M3 1 n.s 99.0 Moderately correlated
19 HERV17-int 1 * 28.9 Weakly correlated
20 AluYm1 1 n.s 19.6 Weakly correlated
21 AluY 1 n.s 74.0 Weakly correlated
22 AluSp 1 n.s 74.0 Weakly correlated
Motif in Repeats The motif of KZFPs identified by the MEME-ChIP is present in repeats sequences. :
# Repeats name Record number Significance Emergence time(Mya) Time correlation with KZFP
1 AluY 1 n.s 74.0 Weakly correlated
Motif in Repeats Consensus The motif of KZFPs identified by MEME-ChIP analysis can be utilized to locate the corresponding region within the consensus sequences of repeats. :
# Repeats name Emergence time(Mya) Time correlation with KZFP