ZRdb KZFP & Repeats
...

Human_ZNF383

  • Protein
    Zinc finger protein 383
  • Length
    475
  • Organism
    Homo sapiens (Human)
  • Time of emergence
    99.0 Mya
  • Time of Changing in binding specificity
    99.0 Mya
  • Uniprot_ID
    Q8NA42
  • NCBI_ID
    163087
Sequence:
MAEGSVMFSDVSIDFSQEEWDCLDPVQRDLYRDVMLENYGNLVSMGLYTPKPQVISLLEQGKEPWMVGRELTRGLCSDLESMCETKLLSLKKEVYEIELCQREIMGLTKHGLEYSSFGDVLEYRSHLAKQLGYPNGHFSQEIFTPEYMPTFIQQTFLTLHQIINNEDRPYECKKCGKAFSQNSQFIQHQRIHIGEKSYECKECGKFFSCGSHVTRHLKIHTGEKPFECKECGKAFSCSSYLSQHQRIHTGKKPYECKECGKAFSYCSNLIDHQRIHTGEKPYECKVCGKAFTKSSQLFQHARIHTGEKPYECKECGKAFTQSSKLVQHQRIHTGEKPYECKECGKAFSSGSALTNHQRIHTGEKPYDCKECGKAFTQSSQLRQHQRIHAGEKPFECLECGKAFTQNSQLFQHQRIHTDEKPYECNECGKAFNKCSNLTRHLRIHTGEKPYNCKECGKAFSSGSDLIRHQGIHTNK
Domain KRAB, ZF, and degenerated ZF domains of KZFPs. :
...
# Domain name Pos
1 KRAB 6..77
2 C2h2 170..192
3 C2h2 198..220
4 C2h2 226..248
5 C2h2 254..276
6 C2h2 282..304
7 C2h2 310..332
8 C2h2 338..360
9 C2h2 366..388
10 C2h2 394..416
11 C2h2 422..444
12 C2h2 450..472
Gene Ontology Annotation The Gene Ontology (GO) describes knowledge of the biological domain based on three aspects: Molecular function, Biological process, and Cellular component. :
# Type TERM
1 Cellular Component cytoplasm
2 Cellular Component nuclear membrane
3 Cellular Component nucleoplasm
4 Molecular Function DNA-binding transcription factor activity
5 Molecular Function metal ion binding
6 Molecular Function RNA polymerase II cis-regulatory region sequence-specific DNA binding
7 Biological Process regulation of transcription by RNA polymerase II
Is there ChIP-seq data Is there any ChIP-seq data available for these KZFPs in the Cistrome database? :
Yes
Motif(meme-ChIP) DNA binding motifs of KZFPs obtained using meme-ChIP and mapped using pylogo. :
Forward:
...
Reverse:
...
Peak overlapping A ChIP-seq peak of KZFPs that intersects with a certain repeats sequences on the genome. :
# Repeats name Record number Significance Emergence time(Mya) Time correlation with KZFP
1 MLT1J 94 **** 99.0 Highly correlated
2 MLT1J2 79 **** 99.0 Highly correlated
3 MLT1J1 14 **** 99.0 Highly correlated
4 MLT1L 12 **** 99.0 Highly correlated
5 L2a 11 n.s 99.0 Highly correlated
6 MIRb 8 n.s 99.0 Highly correlated
7 AluJr 7 n.s 74.0 Weakly correlated
8 MIR3 7 n.s 99.0 Highly correlated
9 AluY 6 n.s 74.0 Weakly correlated
10 MIR 6 n.s 99.0 Highly correlated
11 AluSz6 6 n.s 74.0 Weakly correlated
12 AluJo 5 n.s 74.0 Weakly correlated
13 AluJb 5 n.s 74.0 Weakly correlated
14 L1PB1 4 n.s 74.0 Weakly correlated
15 LTR10A 4 **** 28.9 Weakly correlated
16 L2b 4 n.s 99.0 Highly correlated
17 L1PA5 4 n.s 19.6 Weakly correlated
18 AluSx1 4 n.s 74.0 Weakly correlated
19 AluSz 4 n.s 74.0 Weakly correlated
20 MLT1K 3 n.s 99.0 Highly correlated
21 AluSq2 3 n.s 74.0 Weakly correlated
22 MLT1A0 3 n.s 99.0 Highly correlated
23 L1PA2 3 n.s 15.2 Weakly correlated
24 L1P1 3 * 19.6 Weakly correlated
25 L1ME4b 2 n.s 99.0 Highly correlated
26 AluSx 2 n.s 74.0 Weakly correlated
27 AluSp 2 n.s 74.0 Weakly correlated
28 L2c 2 n.s 99.0 Highly correlated
29 AluSx3 2 n.s 74.0 Weakly correlated
30 MIRc 2 n.s 99.0 Highly correlated
31 MLT1D 2 n.s 99.0 Highly correlated
32 AluYm1 2 * 19.6 Weakly correlated
33 AluSq 1 n.s 74.0 Weakly correlated
34 MER4C 1 ** 74.0 Weakly correlated
35 MIR1_Amn 1 n.s 319.0 Weakly correlated
36 MER83B-int 1 ** 99.0 Highly correlated
37 MER74A 1 * 99.0 Highly correlated
38 MER65D 1 ** 87.0 Weakly correlated
39 MER52C 1 ** 74.0 Weakly correlated
40 MER50 1 n.s 43.0 Weakly correlated
41 LTR65 1 ** 99.0 Highly correlated
42 MLT1A1 1 n.s 87.0 Weakly correlated
43 MLT1F1 1 n.s 99.0 Highly correlated
44 AluSg7 1 n.s 74.0 Weakly correlated
45 AluSg 1 n.s 74.0 Weakly correlated
46 AluSc5 1 n.s 74.0 Weakly correlated
47 AluJr4 1 n.s 74.0 Weakly correlated
48 MLT1N2 1 n.s 99.0 Highly correlated
49 MSTB2 1 * 74.0 Weakly correlated
50 MSTD 1 n.s 74.0 Weakly correlated
51 THE1C-int 1 n.s 43.0 Weakly correlated
52 L1MEg 1 n.s 99.0 Highly correlated
53 ERV3-16A3_I-int 1 n.s 99.0 Highly correlated
54 ERVL-E-int 1 n.s 99.0 Highly correlated
55 FLAM_C 1 n.s 74.0 Weakly correlated
56 FRAM 1 n.s 74.0 Weakly correlated
57 HERVFH21-int 1 ** 28.9 Weakly correlated
58 L1M5 1 n.s 99.0 Highly correlated
59 L1MA6 1 n.s 87.0 Weakly correlated
60 L1MB8 1 n.s 99.0 Highly correlated
61 L1MCa 1 n.s 99.0 Highly correlated
62 L1MDb 1 * 99.0 Highly correlated
63 L1ME3E 1 n.s 99.0 Highly correlated
64 MER41A 1 n.s 74.0 Weakly correlated
65 AluYh9 1 **** 15.2 Weakly correlated
66 L1PB2 1 n.s 74.0 Weakly correlated
67 L3b 1 n.s 99.0 Highly correlated
68 LTR13 1 * 19.6 Weakly correlated
69 LTR16 1 n.s 99.0 Highly correlated
70 LTR16A1 1 * 99.0 Highly correlated
71 LTR30 1 *** 28.9 Weakly correlated
72 LTR33 1 n.s 99.0 Highly correlated
73 LTR8 1 n.s 43.0 Weakly correlated
74 LTR82A 1 ** 99.0 Highly correlated
75 MER39B 1 * 74.0 Weakly correlated
Motif in Repeats The motif of KZFPs identified by the MEME-ChIP is present in repeats sequences. :
# Repeats name Record number Significance Emergence time(Mya) Time correlation with KZFP
1 MLT1J 91 **** 99.0 Highly correlated
2 MLT1J2 72 **** 99.0 Highly correlated
3 MLT1J1 13 **** 99.0 Highly correlated
4 MLT1L 11 **** 99.0 Highly correlated
5 AluSz6 4 n.s 74.0 Weakly correlated
6 L2a 3 n.s 99.0 Highly correlated
7 MLT1K 3 n.s 99.0 Highly correlated
8 L1PA5 2 n.s 19.6 Weakly correlated
9 L1PB1 2 n.s 74.0 Weakly correlated
10 MIRb 2 n.s 99.0 Highly correlated
11 L1MCa 1 n.s 99.0 Highly correlated
12 HERVFH21-int 1 ** 28.9 Weakly correlated
13 AluJb 1 n.s 74.0 Weakly correlated
14 MLT1A0 1 n.s 99.0 Highly correlated
15 L1MEg 1 n.s 99.0 Highly correlated
16 L1MB8 1 n.s 99.0 Highly correlated
17 MER4C 1 ** 74.0 Weakly correlated
18 MLT1D 1 n.s 99.0 Highly correlated
19 MIR1_Amn 1 n.s 319.0 Weakly correlated
20 L1P1 1 n.s 19.6 Weakly correlated
21 MIR3 1 n.s 99.0 Highly correlated
22 MER83B-int 1 ** 99.0 Highly correlated
23 MER74A 1 * 99.0 Highly correlated
24 AluYm1 1 n.s 19.6 Weakly correlated
25 LTR13 1 * 19.6 Weakly correlated
26 LTR8 1 n.s 43.0 Weakly correlated
Motif in Repeats Consensus The motif of KZFPs identified by MEME-ChIP analysis can be utilized to locate the corresponding region within the consensus sequences of repeats. :
# Repeats name Emergence time(Mya) Time correlation with KZFP
1 MLT1J 99.0 Highly correlated
2 MLT1J2 99.0 Highly correlated
3 MLT1L 99.0 Highly correlated