ZRdb KZFP & Repeats
...

Human_ZNF302

  • Protein
    Zinc finger protein 302
  • Length
    478
  • Organism
    Homo sapiens (Human)
  • Time of emergence
    94.0 Mya
  • Time of Changing in binding specificity
    43.0 Mya
  • Uniprot_ID
    Q9NR11
  • NCBI_ID
    55900
Sequence:
MSQVTFSDVAIDFSHEEWACLDSAQRDLYKDVMVQNYENLVSVGLSVTKPYVIMLLEDGKEPWMMEKKLSKAYPFPLSHSVPASVNFGFSALFEHCSEVTEIFELSELCVFWVLHFLSNSPNSTVEAFSRSKKKKKKKKKRQCFAFLIYFRLGIKMGKQGIINKEGYLYEDSPQPVTMEKVVKQSYEFSNSNKNLEYTECDTFRSTFHSKSTLSEPQNNSAEGNSHKYDILKKNLSKKSVIKSERINGGKKLLNSNKSGAAFNQSKSLTLPQTCNREKIYTCSECGKAFGKQSILSRHWRIHTGEKPYECRECGKTFSHGSSLTRHQISHSGEKPYKCIECGKAFSHGSSLTNHQSTHTGEKPYECMNCGKSFSRVSLLIQHLRIHTQEKRYECRICGKAFIHSSSLIHHQKSHTGEKPYECRECGKAFCCSSHLTQHQRIHSMKKKYECNKCLKVFSSFSFLVQHQSIHTEEKPFEV
Domain KRAB, ZF, and degenerated ZF domains of KZFPs. :
...
# Domain name Pos
1 KRAB 4..75
2 C2h2 280..302
3 C2h2 308..330
4 C2h2 336..358
5 C2h2 364..386
6 C2h2 392..414
7 C2h2 420..442
8 C2h2 448..470
Gene Ontology Annotation The Gene Ontology (GO) describes knowledge of the biological domain based on three aspects: Molecular function, Biological process, and Cellular component. :
# Type TERM
1 Cellular Component nucleus
2 Molecular Function DNA-binding transcription factor activity, RNA polymerase II-specific
3 Molecular Function metal ion binding
4 Molecular Function RNA polymerase II cis-regulatory region sequence-specific DNA binding
5 Biological Process regulation of transcription by RNA polymerase II
Is there ChIP-seq data Is there any ChIP-seq data available for these KZFPs in the Cistrome database? :
Yes
Motif(meme-ChIP) DNA binding motifs of KZFPs obtained using meme-ChIP and mapped using pylogo. :
Forward:
...
Reverse:
...
Peak overlapping A ChIP-seq peak of KZFPs that intersects with a certain repeats sequences on the genome. :
# Repeats name Record number Significance Emergence time(Mya) Time correlation with KZFP
1 HERVL-int 227 **** 74.0 Weakly correlated
2 AluY 23 **** 74.0 Weakly correlated
3 LTR12C 8 **** 19.6 Weakly correlated
4 AluJb 7 n.s 74.0 Weakly correlated
5 AluSx 6 n.s 74.0 Weakly correlated
6 ERVL-int 5 **** 99.0 Weakly correlated
7 SVA_D 4 *** 15.2 Weakly correlated
8 MSTA-int 4 ** 43.0 Highly correlated
9 LTR10A 4 **** 28.9 Weakly correlated
10 AluSx1 4 n.s 74.0 Weakly correlated
11 AluSx3 4 n.s 74.0 Weakly correlated
12 L1P3 4 *** 74.0 Weakly correlated
13 AluYj4 3 **** 0.0 Weakly correlated
14 AluJo 3 n.s 74.0 Weakly correlated
15 L1MA9 3 n.s 99.0 Weakly correlated
16 L1PA5 3 n.s 19.6 Weakly correlated
17 L2c 3 n.s 99.0 Weakly correlated
18 MER50 3 *** 43.0 Highly correlated
19 MamRTE1 3 *** 99.0 Weakly correlated
20 THE1D-int 3 ** 28.9 Weakly correlated
21 AluSq2 3 n.s 74.0 Weakly correlated
22 AluSp 3 n.s 74.0 Weakly correlated
23 AluSc8 3 n.s 74.0 Weakly correlated
24 LTR12D 2 *** 19.6 Weakly correlated
25 L1PA4 2 n.s 19.6 Weakly correlated
26 L2b 2 n.s 99.0 Weakly correlated
27 MLT1E2 2 ** 99.0 Weakly correlated
28 L1PA12 2 ** 74.0 Weakly correlated
29 AluSq10 2 *** 74.0 Weakly correlated
30 AluSz 2 n.s 74.0 Weakly correlated
31 SVA_B 2 *** 15.2 Weakly correlated
32 SVA_C 2 *** 15.2 Weakly correlated
33 AluSc 2 n.s 74.0 Weakly correlated
34 ERVL-B4-int 2 * 99.0 Weakly correlated
35 AluYm1 2 ** 19.6 Weakly correlated
36 AluYk4 2 **** 15.2 Weakly correlated
37 AluSg7 1 n.s 74.0 Weakly correlated
38 LTR22B1 1 *** 28.9 Weakly correlated
39 MER52A 1 n.s 74.0 Weakly correlated
40 MER65C 1 ** 74.0 Weakly correlated
41 MER39B 1 ** 74.0 Weakly correlated
42 MER9a2 1 *** 19.6 Weakly correlated
43 LTR46 1 *** 43.0 Highly correlated
44 AluJr 1 n.s 74.0 Weakly correlated
45 MIR 1 n.s 99.0 Weakly correlated
46 MIRb 1 n.s 99.0 Weakly correlated
47 MLT1A0-int 1 ** 99.0 Weakly correlated
48 MLT1E3 1 * 99.0 Weakly correlated
49 MLT1J1 1 * 99.0 Weakly correlated
50 MLT1L 1 n.s 99.0 Weakly correlated
51 AluSg 1 n.s 74.0 Weakly correlated
52 MSTB-int 1 * 43.0 Highly correlated
53 SVA_A 1 ** 19.6 Weakly correlated
54 SVA_F 1 * 0.0 Weakly correlated
55 THE1C-int 1 n.s 43.0 Highly correlated
56 AluYh9 1 **** 15.2 Weakly correlated
57 L1P1 1 n.s 19.6 Weakly correlated
58 AluYe5 1 ** 74.0 Weakly correlated
59 AluYk11 1 *** 15.2 Weakly correlated
60 ERVL-E-int 1 n.s 99.0 Weakly correlated
61 AluYc 1 * 74.0 Weakly correlated
62 FRAM 1 * 74.0 Weakly correlated
63 HERVK14-int 1 ** 28.9 Weakly correlated
64 AluYa5 1 * 15.2 Weakly correlated
65 L1MA8 1 n.s 87.0 Weakly correlated
66 AluSz6 1 n.s 74.0 Weakly correlated
67 L1MB3 1 n.s 99.0 Weakly correlated
68 L1ME1 1 n.s 99.0 Weakly correlated
69 LTR18A 1 *** 43.0 Highly correlated
70 L1P4 1 n.s 74.0 Weakly correlated
71 L1PA13 1 n.s 74.0 Weakly correlated
72 L1PA16 1 n.s 74.0 Weakly correlated
73 L1PA2 1 n.s 15.2 Weakly correlated
74 L1PA7 1 n.s 74.0 Weakly correlated
75 L1PB1 1 n.s 74.0 Weakly correlated
76 LFSINE_Vert 1 ** 319.0 Weakly correlated
77 AluSq 1 n.s 74.0 Weakly correlated
78 LTR12E 1 *** 19.6 Weakly correlated
79 LTR13 1 ** 19.6 Weakly correlated
80 LTR16A 1 * 99.0 Weakly correlated
Motif in Repeats The motif of KZFPs identified by the MEME-ChIP is present in repeats sequences. :
# Repeats name Record number Significance Emergence time(Mya) Time correlation with KZFP
1 HERVL-int 212 **** 74.0 Weakly correlated
2 ERVL-int 5 **** 99.0 Weakly correlated
3 MSTA-int 3 ** 43.0 Highly correlated
4 ERVL-B4-int 2 * 99.0 Weakly correlated
5 L1MB3 1 n.s 99.0 Weakly correlated
6 AluSx1 1 n.s 74.0 Weakly correlated
7 L2c 1 n.s 99.0 Weakly correlated
8 THE1D-int 1 n.s 28.9 Weakly correlated
9 ERVL-E-int 1 n.s 99.0 Weakly correlated
10 MIR 1 n.s 99.0 Weakly correlated
11 L1PA2 1 n.s 15.2 Weakly correlated
12 MLT1A0-int 1 ** 99.0 Weakly correlated
13 L2b 1 n.s 99.0 Weakly correlated
14 MER65C 1 ** 74.0 Weakly correlated
Motif in Repeats Consensus The motif of KZFPs identified by MEME-ChIP analysis can be utilized to locate the corresponding region within the consensus sequences of repeats. :
# Repeats name Emergence time(Mya) Time correlation with KZFP
1 HERVL-INT 74.0 Weakly correlated