ZRdb KZFP & Repeats
...

Human_ZNF300

  • Protein
    Zinc finger protein 300
  • Length
    604
  • Organism
    Homo sapiens (Human)
  • Time of emergence
    99.0 Mya
  • Time of Changing in binding specificity
    99.0 Mya
  • Uniprot_ID
    Q96RE9
  • NCBI_ID
    91975
Sequence:
MMKSQGLVSFKDVAVDFTQEEWQQLDPSQRTLYRDVMLENYSHLVSMGYPVSKPDVISKLEQGEEPWIIKGDISNWIYPDEYQADGRQDRKSNLHNSQSCILGTVSFHHKILKGVTRDGSLCSILKVCQGDGQLQRFLENQDKLFRQVTFVNSKTVTEASGHKYNPLGKIFQECIETDISIQRFHKYDAFKKNLKPNIDLPSCYKSNSRKKPDQSFGGGKSSSQSEPNSNLEKIHNGVIPFDDNQCGNVFRNTQSLIQYQNVETKEKSCVCVTCGKAFAKKSQLIVHQRIHTGKKPYDCGACGKAFSEKFHLVVHQRTHTGEKPYDCSECGKAFSQKSSLIIHQRVHTGEKPYECSECGKAFSQKSPLIIHQRIHTGEKPYECRECGKAFSQKSQLIIHHRAHTGEKPYECTECGKAFCEKSHLIIHKRIHTGEKPYKCAQCEEAFSRKTELITHQLVHTGEKPYECTECGKTFSRKSQLIIHQRTHTGEKPYKCSECGKAFCQKSHLIGHQRIHTGEKPYICTECGKAFSQKSHLPGHQRIHTGEKPYICAECGKAFSQKSDLVLHQRIHTGERPYQCAICGKAFIQKSQLTVHQRIHTVVKS
Domain KRAB, ZF, and degenerated ZF domains of KZFPs. :
...
# Domain name Pos
1 KRAB 8..79
2 C2h2 269..291
3 C2h2 297..319
4 C2h2 325..347
5 C2h2 353..375
6 C2h2 381..403
7 C2h2 409..431
8 C2h2 437..459
9 C2h2 465..487
10 C2h2 493..515
11 C2h2 521..543
12 C2h2 549..571
13 C2h2 577..599
Gene Ontology Annotation The Gene Ontology (GO) describes knowledge of the biological domain based on three aspects: Molecular function, Biological process, and Cellular component. :
# Type TERM
1 Cellular Component nuclear body
2 Cellular Component nucleolus
3 Cellular Component nucleoplasm
4 Cellular Component nucleus
5 Molecular Function DNA-binding transcription activator activity, RNA polymerase II-specific
6 Molecular Function DNA-binding transcription factor activity, RNA polymerase II-specific
7 Molecular Function metal ion binding
8 Molecular Function RNA polymerase II cis-regulatory region sequence-specific DNA binding
9 Molecular Function sequence-specific DNA binding
10 Biological Process positive regulation of transcription by RNA polymerase II
11 Biological Process regulation of transcription by RNA polymerase II
Is there ChIP-seq data Is there any ChIP-seq data available for these KZFPs in the Cistrome database? :
Yes
Motif(meme-ChIP) DNA binding motifs of KZFPs obtained using meme-ChIP and mapped using pylogo. :
Forward:
...
Reverse:
...
Peak overlapping A ChIP-seq peak of KZFPs that intersects with a certain repeats sequences on the genome. :
# Repeats name Record number Significance Emergence time(Mya) Time correlation with KZFP
1 AluY 4 n.s 74.0 Weakly correlated
2 LTR10A 4 **** 28.9 Weakly correlated
3 HERV17-int 2 *** 28.9 Weakly correlated
4 L2a 2 n.s 99.0 Highly correlated
5 AluJb 2 n.s 74.0 Weakly correlated
6 L1PA5 2 n.s 19.6 Weakly correlated
7 L1PA2 1 n.s 15.2 Weakly correlated
8 SVA_D 1 * 15.2 Weakly correlated
9 MSTB1 1 * 74.0 Weakly correlated
10 MIR 1 n.s 99.0 Highly correlated
11 MER39B 1 ** 74.0 Weakly correlated
12 LTR13 1 ** 19.6 Weakly correlated
13 L2c 1 n.s 99.0 Highly correlated
14 L1PA4 1 n.s 19.6 Weakly correlated
15 L1P1 1 * 19.6 Weakly correlated
16 HAL1 1 n.s 99.0 Highly correlated
17 AluYj4 1 ** 0.0 Weakly correlated
18 AluYh9 1 **** 15.2 Weakly correlated
19 AluSx1 1 n.s 74.0 Weakly correlated
20 AluSq2 1 n.s 74.0 Weakly correlated
21 AluSp 1 n.s 74.0 Weakly correlated
22 AluJo 1 n.s 74.0 Weakly correlated
Motif in Repeats The motif of KZFPs identified by the MEME-ChIP is present in repeats sequences. :
# Repeats name Record number Significance Emergence time(Mya) Time correlation with KZFP
1 AluYh9 1 **** 15.2 Weakly correlated
2 AluYj4 1 ** 0.0 Weakly correlated
3 L1PA2 1 n.s 15.2 Weakly correlated
Motif in Repeats Consensus The motif of KZFPs identified by MEME-ChIP analysis can be utilized to locate the corresponding region within the consensus sequences of repeats. :
# Repeats name Emergence time(Mya) Time correlation with KZFP