ZRdb KZFP & Repeats
...

Human_ZNF286A

  • Protein
    Zinc finger protein 286A
  • Length
    521
  • Organism
    Homo sapiens (Human)
  • Time of emergence
    160.0 Mya
  • Time of Changing in binding specificity
    160.0 Mya
  • Uniprot_ID
    Q9HBT8
  • NCBI_ID
    57335
Sequence:
METDLAEMPEKGALSSQDSPHFQEKSTEEGEVAALRLTARSQETVTFKDVAMDFTPEEWGKLDPAQRDVMLENYRNLVSLWLPVSKPESYNLENGKEPLKLERKAPKSSYSDMETRPQSKDSTSVQDFSKAESCKVAIIDRLTRNSVYDSNLEAALECENWLENQQGNQERHLREMFTHMNSLSEETDHKHDVYWKSFNQKSVLITEDRVPKGSYAFHTLEKSLKQKSNLMKKQRTYKEKKPHKCNDCGELFTYHSVLIRHQRVHTGEKPYTCNECGKSFSHRANLTKHQRTHTRILFECSECKKTFTESSSLATHQRIHVGERPYECNECGKGFNRSTHLVQHQLIHTGVKPYECNECDKAFIHSSALIKHQRTHTGEKPYKCQECGKAFSHCSSLTKHQRVHTGEKPYECSECGKTFSQSTHLVQHQRIHTGEKPYECNECGKTFSRSSNFAKHQRIHIGKKPYKCSECGKAFIHSSALIQHQRTHTGEKPFRCNECGKSFKCSSSLIRHQRVHTEEQP
Domain KRAB, ZF, and degenerated ZF domains of KZFPs. :
...
# Domain name Pos
1 KRAB 45..111
2 C2h2 243..265
3 C2h2 271..293
4 C2h2 298..320
5 C2h2 326..348
6 C2h2 354..376
7 C2h2 382..404
8 C2h2 410..432
9 C2h2 438..460
10 C2h2 466..488
11 C2h2 494..516
Gene Ontology Annotation The Gene Ontology (GO) describes knowledge of the biological domain based on three aspects: Molecular function, Biological process, and Cellular component. :
# Type TERM
1 Cellular Component nucleus
2 Molecular Function DNA-binding transcription factor activity, RNA polymerase II-specific
3 Molecular Function metal ion binding
4 Molecular Function RNA polymerase II cis-regulatory region sequence-specific DNA binding
5 Biological Process regulation of transcription by RNA polymerase II
Is there ChIP-seq data Is there any ChIP-seq data available for these KZFPs in the Cistrome database? :
Yes
Motif(meme-ChIP) DNA binding motifs of KZFPs obtained using meme-ChIP and mapped using pylogo. :
Forward:
...
Reverse:
...
Peak overlapping A ChIP-seq peak of KZFPs that intersects with a certain repeats sequences on the genome. :
# Repeats name Record number Significance Emergence time(Mya) Time correlation with KZFP
1 L3 209 **** 99.0 Weakly correlated
2 MIRb 18 n.s 99.0 Weakly correlated
3 AluJb 16 n.s 74.0 Weakly correlated
4 CR1-3_Croc 16 **** 319.0 Weakly correlated
5 L1P3 9 **** 74.0 Weakly correlated
6 LTR8 8 **** 43.0 Weakly correlated
7 AluSc8 8 ** 74.0 Weakly correlated
8 AluSz 7 n.s 74.0 Weakly correlated
9 SVA_F 6 **** 0.0 Weakly correlated
10 AluSx1 5 n.s 74.0 Weakly correlated
11 MIR 5 n.s 99.0 Weakly correlated
12 MIR3 5 n.s 99.0 Weakly correlated
13 AluY 5 n.s 74.0 Weakly correlated
14 AluSx 5 n.s 74.0 Weakly correlated
15 AluYa5 4 *** 15.2 Weakly correlated
16 MIRc 4 n.s 99.0 Weakly correlated
17 L1MC4 4 n.s 99.0 Weakly correlated
18 LTR10A 4 **** 28.9 Weakly correlated
19 L2c 4 n.s 99.0 Weakly correlated
20 L2b 4 n.s 99.0 Weakly correlated
21 AluSz6 3 n.s 74.0 Weakly correlated
22 SVA_D 3 * 15.2 Weakly correlated
23 AluYj4 3 *** 0.0 Weakly correlated
24 FRAM 3 ** 74.0 Weakly correlated
25 L3b 3 ** 99.0 Weakly correlated
26 AluJo 2 n.s 74.0 Weakly correlated
27 L1PA14 2 n.s 74.0 Weakly correlated
28 L1PA2 2 n.s 15.2 Weakly correlated
29 L2a 2 n.s 99.0 Weakly correlated
30 AluSg 2 n.s 74.0 Weakly correlated
31 AluSc 2 n.s 74.0 Weakly correlated
32 MER21B 2 * 99.0 Weakly correlated
33 AluJr 2 n.s 74.0 Weakly correlated
34 L1P4 2 n.s 74.0 Weakly correlated
35 L1MB8 2 n.s 99.0 Weakly correlated
36 L1MA8 2 n.s 87.0 Weakly correlated
37 MLT1L 1 n.s 99.0 Weakly correlated
38 MIR1_Amn 1 n.s 319.0 Weakly correlated
39 ERVL-int 1 * 99.0 Weakly correlated
40 ERV3-16A3_I-int 1 n.s 99.0 Weakly correlated
41 AluSp 1 n.s 74.0 Weakly correlated
42 MLT1D 1 n.s 99.0 Weakly correlated
43 MLT1E3 1 * 99.0 Weakly correlated
44 MLT1K 1 n.s 99.0 Weakly correlated
45 MER77 1 * 99.0 Weakly correlated
46 MLT2C1 1 * 99.0 Weakly correlated
47 MSTD 1 n.s 74.0 Weakly correlated
48 SVA_A 1 * 19.6 Weakly correlated
49 AluYa8 1 *** 15.2 Weakly correlated
50 SVA_E 1 * 0.0 Weakly correlated
51 AluSq 1 n.s 74.0 Weakly correlated
52 FLAM_A 1 n.s 74.0 Weakly correlated
53 MER50 1 n.s 43.0 Weakly correlated
54 FLAM_C 1 n.s 74.0 Weakly correlated
55 HAL1 1 n.s 99.0 Weakly correlated
56 LTR18B 1 ** 43.0 Weakly correlated
57 LTR13 1 * 19.6 Weakly correlated
58 LTR10B1 1 *** 28.9 Weakly correlated
59 L1HS 1 n.s 8.6 Weakly correlated
60 L1M3 1 n.s 99.0 Weakly correlated
61 L1M4 1 n.s 99.0 Weakly correlated
62 L1MA9 1 n.s 99.0 Weakly correlated
63 L2 1 n.s 99.0 Weakly correlated
64 L1ME3G 1 n.s 99.0 Weakly correlated
65 AluSg4 1 n.s 74.0 Weakly correlated
Motif in Repeats The motif of KZFPs identified by the MEME-ChIP is present in repeats sequences. :
# Repeats name Record number Significance Emergence time(Mya) Time correlation with KZFP
1 L3 5 n.s 99.0 Weakly correlated
2 AluYj4 1 n.s 0.0 Weakly correlated
3 AluSz 1 n.s 74.0 Weakly correlated
4 L2c 1 n.s 99.0 Weakly correlated
Motif in Repeats Consensus The motif of KZFPs identified by MEME-ChIP analysis can be utilized to locate the corresponding region within the consensus sequences of repeats. :
# Repeats name Emergence time(Mya) Time correlation with KZFP