ZRdb KZFP & Repeats
...

Human_ZNF267

  • Protein
    Zinc finger protein 267
  • Length
    743
  • Organism
    Homo sapiens (Human)
  • Time of emergence
    43.0 Mya
  • Time of Changing in binding specificity
    43.0 Mya
  • Uniprot_ID
    Q14586
  • NCBI_ID
    10308
Sequence:
MGLLTFRDVAVEFSLEEWEHLEPAQKNLYQDVMLENYRNLVSLGLVVSKPDLITFLEQRKEPWNVKSEETVAIQPDVFSHYNKDLLTEHCTEASFQKVISRRHGSCDLENLHLRKRWKREECEGHNGCYDEKTFKYDQFDESSVESLFHQQILSSCAKSYNFDQYRKVFTHSSLLNQQEEIDIWGKHHIYDKTSVLFRQVSTLNSYRNVFIGEKNYHCNNSEKTLNQSSSPKNHQENYFLEKQYKCKEFEEVFLQSMHGQEKQEQSYKCNKCVEVCTQSLKHIQHQTIHIRENSYSYNKYDKDLSQSSNLRKQIIHNEEKPYKCEKCGDSLNHSLHLTQHQIIPTEEKPCKWKECGKVFNLNCSLYLTKQQQIDTGENLYKCKACSKSFTRSSNLIVHQRIHTGEKPYKCKECGKAFRCSSYLTKHKRIHTGEKPYKCKECGKAFNRSSCLTQHQTTHTGEKLYKCKVCSKSYARSSNLIMHQRVHTGEKPYKCKECGKVFSRSSCLTQHRKIHTGENLYKCKVCAKPFTCFSNLIVHERIHTGEKPYKCKECGKAFPYSSHLIRHHRIHTGEKPYKCKACSKSFSDSSGLTVHRRTHTGEKPYTCKECGKAFSYSSDVIQHRRIHTGQRPYKCEECGKAFNYRSYLTTHQRSHTGERPYKCEECGKAFNSRSYLTTHRRRHTGERPYKCDECGKAFSYRSYLTTHRRSHSGERPYKCEECGKAFNSRSYLIAHQRSHTREKL
Domain KRAB, ZF, and degenerated ZF domains of KZFPs. :
...
# Domain name Pos
1 KRAB 4..75
2 C2h2 267..289
3 C2h2 322..340
4 C2h2 380..402
5 C2h2 408..430
6 C2h2 436..458
7 C2h2 464..486
8 C2h2 492..514
9 C2h2 520..542
10 C2h2 548..570
11 C2h2 576..598
12 C2h2 604..626
13 C2h2 632..654
14 C2h2 660..682
15 C2h2 688..710
16 C2h2 716..738
Gene Ontology Annotation The Gene Ontology (GO) describes knowledge of the biological domain based on three aspects: Molecular function, Biological process, and Cellular component. :
# Type TERM
1 Cellular Component nucleus
2 Molecular Function DNA-binding transcription activator activity, RNA polymerase II-specific
3 Molecular Function metal ion binding
4 Molecular Function RNA polymerase II cis-regulatory region sequence-specific DNA binding
5 Biological Process regulation of transcription by RNA polymerase II
Is there ChIP-seq data Is there any ChIP-seq data available for these KZFPs in the Cistrome database? :
Yes
Motif(meme-ChIP) DNA binding motifs of KZFPs obtained using meme-ChIP and mapped using pylogo. :
Forward:
...
Reverse:
...
Peak overlapping A ChIP-seq peak of KZFPs that intersects with a certain repeats sequences on the genome. :
# Repeats name Record number Significance Emergence time(Mya) Time correlation with KZFP
1 THE1C 733 **** 43.0 Highly correlated
2 MSTA 168 **** 43.0 Highly correlated
3 THE1D 162 **** 43.0 Highly correlated
4 L2a 10 n.s 99.0 Weakly correlated
5 AluSx 10 n.s 74.0 Weakly correlated
6 L2b 7 n.s 99.0 Weakly correlated
7 AluY 7 n.s 74.0 Weakly correlated
8 AluSx1 5 n.s 74.0 Weakly correlated
9 MIRc 4 n.s 99.0 Weakly correlated
10 THE1B 4 n.s 43.0 Highly correlated
11 L1P3 4 * 74.0 Weakly correlated
12 MIR3 4 n.s 99.0 Weakly correlated
13 AluSz 4 n.s 74.0 Weakly correlated
14 L2c 3 n.s 99.0 Weakly correlated
15 LTR10A 3 **** 28.9 Weakly correlated
16 AluSz6 3 n.s 74.0 Weakly correlated
17 MIRb 3 n.s 99.0 Weakly correlated
18 AluJb 3 n.s 74.0 Weakly correlated
19 MIR 2 n.s 99.0 Weakly correlated
20 L2 2 n.s 99.0 Weakly correlated
21 L1PA2 2 n.s 15.2 Weakly correlated
22 MLT1B 2 n.s 99.0 Weakly correlated
23 L1PA5 2 n.s 19.6 Weakly correlated
24 THE1D-int 2 n.s 28.9 Weakly correlated
25 FRAM 2 * 74.0 Weakly correlated
26 LTR13 2 ** 19.6 Weakly correlated
27 MamRTE1 2 * 99.0 Weakly correlated
28 AluSq2 2 n.s 74.0 Weakly correlated
29 AluSq 2 n.s 74.0 Weakly correlated
30 AluSp 2 n.s 74.0 Weakly correlated
31 AluSc8 2 n.s 74.0 Weakly correlated
32 AluJr 2 n.s 74.0 Weakly correlated
33 MER41D 1 ** 74.0 Weakly correlated
34 MER39B 1 * 74.0 Weakly correlated
35 MER21B 1 n.s 99.0 Weakly correlated
36 L1PBa1 1 n.s 74.0 Weakly correlated
37 LTR88b 1 * 99.0 Weakly correlated
38 MER50 1 n.s 43.0 Highly correlated
39 MER66B 1 * 43.0 Highly correlated
40 MER66D 1 *** 43.0 Highly correlated
41 MER67B 1 ** 99.0 Weakly correlated
42 MLT1J 1 n.s 99.0 Weakly correlated
43 MLT1J2 1 n.s 99.0 Weakly correlated
44 MLT1L 1 n.s 99.0 Weakly correlated
45 MLT1O 1 n.s 99.0 Weakly correlated
46 MLT2B4 1 n.s 99.0 Weakly correlated
47 MSTB1 1 n.s 74.0 Weakly correlated
48 MamSINE1 1 n.s 99.0 Weakly correlated
49 THE1C-int 1 n.s 43.0 Highly correlated
50 L1M3 1 n.s 99.0 Weakly correlated
51 AluJo 1 n.s 74.0 Weakly correlated
52 AluSc 1 n.s 74.0 Weakly correlated
53 AluSc5 1 n.s 74.0 Weakly correlated
54 AluSg 1 n.s 74.0 Weakly correlated
55 AluSg7 1 n.s 74.0 Weakly correlated
56 AluSx3 1 n.s 74.0 Weakly correlated
57 AluSx4 1 n.s 74.0 Weakly correlated
58 AluYb8 1 n.s 15.2 Weakly correlated
59 AluYj4 1 n.s 0.0 Weakly correlated
60 FLAM_C 1 n.s 74.0 Weakly correlated
61 HAL1 1 n.s 99.0 Weakly correlated
62 HAL1ME 1 n.s 99.0 Weakly correlated
63 HERV3-int 1 * 28.9 Weakly correlated
64 LTR78 1 n.s 99.0 Weakly correlated
65 L1MA9 1 n.s 99.0 Weakly correlated
66 L1MB5 1 n.s 99.0 Weakly correlated
67 L1MC 1 n.s 99.0 Weakly correlated
68 L1ME1 1 n.s 99.0 Weakly correlated
69 L1P1 1 n.s 19.6 Weakly correlated
70 L1P4 1 n.s 74.0 Weakly correlated
71 L1PA16 1 n.s 74.0 Weakly correlated
72 L1PB4 1 n.s 99.0 Weakly correlated
73 L1PBa 1 n.s 74.0 Weakly correlated
74 L3 1 n.s 99.0 Weakly correlated
75 LTR16E2 1 n.s 99.0 Weakly correlated
76 LTR55 1 ** 99.0 Weakly correlated
77 LTR67B 1 n.s 99.0 Weakly correlated
Motif in Repeats The motif of KZFPs identified by the MEME-ChIP is present in repeats sequences. :
# Repeats name Record number Significance Emergence time(Mya) Time correlation with KZFP
1 THE1C 717 **** 43.0 Highly correlated
2 MSTA 156 **** 43.0 Highly correlated
3 THE1D 147 **** 43.0 Highly correlated
4 THE1B 2 n.s 43.0 Highly correlated
5 L2a 2 n.s 99.0 Weakly correlated
6 MSTB1 1 n.s 74.0 Weakly correlated
7 L2b 1 n.s 99.0 Weakly correlated
8 MER67B 1 ** 99.0 Weakly correlated
9 L1MB5 1 n.s 99.0 Weakly correlated
10 AluSq 1 n.s 74.0 Weakly correlated
11 MLT1L 1 n.s 99.0 Weakly correlated
12 THE1D-int 1 n.s 28.9 Weakly correlated
13 HAL1ME 1 n.s 99.0 Weakly correlated
14 MLT1B 1 n.s 99.0 Weakly correlated
15 MIR3 1 n.s 99.0 Weakly correlated
16 L2c 1 n.s 99.0 Weakly correlated
17 L1PBa1 1 n.s 74.0 Weakly correlated
18 MIRc 1 n.s 99.0 Weakly correlated
19 HERV3-int 1 * 28.9 Weakly correlated
Motif in Repeats Consensus The motif of KZFPs identified by MEME-ChIP analysis can be utilized to locate the corresponding region within the consensus sequences of repeats. :
# Repeats name Emergence time(Mya) Time correlation with KZFP
1 THE1C 43.0 Highly correlated
2 THE1D 43.0 Highly correlated