ZRdb KZFP & Repeats
...

Human_ZNF254

  • Protein
    Zinc finger protein 254
  • Length
    659
  • Organism
    Homo sapiens (Human)
  • Time of emergence
    74.0 Mya
  • Time of Changing in binding specificity
    43.0 Mya
  • Uniprot_ID
    O75437
  • NCBI_ID
    9534
Sequence:
MPGPPRSLEMGLLTFRDVAIEFSLEEWQHLDIAQQNLYRNVMLENYRNLAFLGIAVSKPDLITCLEQGKEPWNMKRHEMVDEPPGMCPHFAQDLWPEQGMEDSFQKAILRRYGKYGHENLQLRKGCKSVDEYKVNKEGYNGLNQCFTTAQSKVFQCDKYLKVFYKFLNSNRPKIRHTEKKSFKCKKRVKLFCMLSHKTQHKSIYHREKSYKCKECGKTFNWSSTLTNHRKIYTEEKPYKCEEYNKSPKQLSTLTTHEIIHAGEKLYKCEECGEAFNRSSNLTTHKIIHTGEKPYKCEECGKAFIWSSTLTEHKKIHTRKKPYKCEECGKAFIWSSTLTRHKRMHTGEKPYKCEECGKAFSQSSTLTTHKIIHTGEKRYKCLECGKAFKQLSTLTTHKIIHVGEKLYKCEECGKGFNRSSNLTTHKIIHTGEKPYKCEECGKAFIWSSTLTKHKRIHTREKPYKCEECGKAFIWSSTLTRHKRMHTGEKPYKCEECGKSFSQSSTLTTHKIIHTGEKPYKCEECGKAFNWSSTLTKHKIIHTEEKPYKCEKCGKAFKQSSILTNHKRIHTGEKPYKCEECGKSFNRSSTFTKHKVIHTGVKPYKCEECGKAFFWSSTLTKHKRIHTGEQPYKWEKFGKAFNRSSHLTTDKITHWREILQV
Domain KRAB, ZF, and degenerated ZF domains of KZFPs. :
...
# Domain name Pos
1 KRAB 13..84
2 dec2h2 210..232
3 dec2h2 238..260
4 C2h2 266..288
5 C2h2 294..316
6 C2h2 322..344
7 C2h2 350..372
8 C2h2 378..400
9 C2h2 406..428
10 C2h2 434..456
11 C2h2 462..484
12 C2h2 490..512
13 C2h2 518..540
14 C2h2 546..568
15 C2h2 574..596
16 C2h2 602..624
Gene Ontology Annotation The Gene Ontology (GO) describes knowledge of the biological domain based on three aspects: Molecular function, Biological process, and Cellular component. :
# Type TERM
1 Cellular Component nucleus
2 Molecular Function DNA-binding transcription factor activity, RNA polymerase II-specific
3 Molecular Function metal ion binding
4 Molecular Function RNA polymerase II cis-regulatory region sequence-specific DNA binding
5 Biological Process negative regulation of transcription by RNA polymerase II
6 Biological Process regulation of transcription by RNA polymerase II
Is there ChIP-seq data Is there any ChIP-seq data available for these KZFPs in the Cistrome database? :
Yes
Motif(meme-ChIP) DNA binding motifs of KZFPs obtained using meme-ChIP and mapped using pylogo. :
Forward:
...
Reverse:
...
Peak overlapping A ChIP-seq peak of KZFPs that intersects with a certain repeats sequences on the genome. :
# Repeats name Record number Significance Emergence time(Mya) Time correlation with KZFP
1 MLT2A1 450 **** 74.0 Weakly correlated
2 MLT2A2 248 **** 74.0 Weakly correlated
3 LOR1a 18 **** 74.0 Weakly correlated
4 LTR22A 14 **** 43.0 Highly correlated
5 AluJb 7 n.s 74.0 Weakly correlated
6 LTR8 4 *** 43.0 Highly correlated
7 AluSz 3 n.s 74.0 Weakly correlated
8 LTR10A 3 **** 28.9 Weakly correlated
9 L1PA5 3 n.s 19.6 Weakly correlated
10 L2a 3 n.s 99.0 Weakly correlated
11 AluSx 3 n.s 74.0 Weakly correlated
12 AluSq2 3 n.s 74.0 Weakly correlated
13 L3 2 n.s 99.0 Weakly correlated
14 L1PA2 2 n.s 15.2 Weakly correlated
15 L1P3 2 n.s 74.0 Weakly correlated
16 L1P1 2 n.s 19.6 Weakly correlated
17 MER50 2 * 43.0 Highly correlated
18 HERVL-int 2 n.s 74.0 Weakly correlated
19 FRAM 2 * 74.0 Weakly correlated
20 MLT1E2 2 * 99.0 Weakly correlated
21 AluY 2 n.s 74.0 Weakly correlated
22 MST-int 1 *** 74.0 Weakly correlated
23 MER50-int 1 * 43.0 Highly correlated
24 MLT2D 1 n.s 99.0 Weakly correlated
25 MLT1J-int 1 * 99.0 Weakly correlated
26 MLT1H 1 n.s 99.0 Weakly correlated
27 LTR13 1 * 19.6 Weakly correlated
28 MLT1B 1 n.s 99.0 Weakly correlated
29 MIRc 1 n.s 99.0 Weakly correlated
30 LTR18C 1 **** 43.0 Highly correlated
31 MIR3 1 n.s 99.0 Weakly correlated
32 LTR2B 1 ** 19.6 Weakly correlated
33 MIR 1 n.s 99.0 Weakly correlated
34 LTR8A 1 * 43.0 Highly correlated
35 MER39B 1 * 74.0 Weakly correlated
36 HAL1 1 n.s 99.0 Weakly correlated
37 AluJr 1 n.s 74.0 Weakly correlated
38 AluSc8 1 n.s 74.0 Weakly correlated
39 AluSg7 1 n.s 74.0 Weakly correlated
40 AluSq10 1 * 74.0 Weakly correlated
41 AluSx1 1 n.s 74.0 Weakly correlated
42 AluSx3 1 n.s 74.0 Weakly correlated
43 AluSz6 1 n.s 74.0 Weakly correlated
44 AluYa5 1 n.s 15.2 Weakly correlated
45 AluYg6 1 ** 15.2 Weakly correlated
46 AluYj4 1 * 0.0 Weakly correlated
47 AluYm1 1 n.s 19.6 Weakly correlated
48 L2c 1 n.s 99.0 Weakly correlated
49 HUERS-P3b-int 1 * 43.0 Highly correlated
50 L1M5 1 n.s 99.0 Weakly correlated
51 L1MA4A 1 n.s 87.0 Weakly correlated
52 L1MA9 1 n.s 99.0 Weakly correlated
53 L1MC5a 1 n.s 99.0 Weakly correlated
54 L1ME2 1 n.s 99.0 Weakly correlated
55 L1ME4b 1 n.s 99.0 Weakly correlated
56 L1P4 1 n.s 74.0 Weakly correlated
57 L1PA4 1 n.s 19.6 Weakly correlated
58 L2b 1 n.s 99.0 Weakly correlated
Motif in Repeats The motif of KZFPs identified by the MEME-ChIP is present in repeats sequences. :
# Repeats name Record number Significance Emergence time(Mya) Time correlation with KZFP
1 MLT2A1 433 **** 74.0 Weakly correlated
2 MLT2A2 248 **** 74.0 Weakly correlated
3 L2a 2 n.s 99.0 Weakly correlated
4 LOR1a 2 *** 74.0 Weakly correlated
5 AluJb 1 n.s 74.0 Weakly correlated
6 HUERS-P3b-int 1 * 43.0 Highly correlated
7 FRAM 1 n.s 74.0 Weakly correlated
8 L3 1 n.s 99.0 Weakly correlated
9 MLT2D 1 n.s 99.0 Weakly correlated
10 MLT1B 1 n.s 99.0 Weakly correlated
11 AluSc8 1 n.s 74.0 Weakly correlated
12 AluSz 1 n.s 74.0 Weakly correlated
13 L2b 1 n.s 99.0 Weakly correlated
14 LTR8A 1 * 43.0 Highly correlated
15 MLT1H 1 n.s 99.0 Weakly correlated
16 AluSq2 1 n.s 74.0 Weakly correlated
Motif in Repeats Consensus The motif of KZFPs identified by MEME-ChIP analysis can be utilized to locate the corresponding region within the consensus sequences of repeats. :
# Repeats name Emergence time(Mya) Time correlation with KZFP
1 MLT2A1 74.0 Weakly correlated
2 MLT2A2 74.0 Weakly correlated