ZRdb KZFP & Repeats
...

Human_ZNF229

  • Protein
    Zinc finger protein 229
  • Length
    825
  • Organism
    Homo sapiens (Human)
  • Time of emergence
    431.0 Mya
  • Time of Changing in binding specificity
    99.0 Mya
  • Uniprot_ID
    Q9UJW7
  • NCBI_ID
    7772
Sequence:
METLTSRHEKRALHSQASAISQDREEKIMSQEPLSFKDVAVVFTEEELELLDSTQRQLYQDVMQENFRNLLSVGERNPLGDKNGKDTEYIQDEELRFFSHKELSSCKIWEEVAGELPGSQDCRVNLQGKDFQFSEDAAPHQGWEGASTPCFPIENFLDSLQGDGLIGLENQQFPAWRAIRPIPIQGSWAKAFVNQLGDVQERCKNLDTEDTVYKCNWDDDSFCWISCHVDHRFPEIDKPCGCNKCRKDCIKNSVLHRINPGENGLKSNEYRNGFRDDADLPPHPRVPLKEKLCQYDEFSEGLRHSAHLNRHQRVPTGEKSVKSLERGRGVRQNTHIRNHPRAPVGDMPYRCDVCGKGFRYKSVLLIHQGVHTGRRPYKCEECGKAFGRSSNLLVHQRVHTGEKPYKCSECGKGFSYSSVLQVHQRLHTGEKPYTCSECGKGFCAKSALHKHQHIHPGEKPYSCGECGKGFSCSSHLSSHQKTHTGERPYQCDKCGKGFSHNSYLQAHQRVHMGQHLYKCNVCGKSFSYSSGLLMHQRLHTGEKPYKCECGKSFGRSSDLHIHQRVHTGEKPYKCSECGKGFRRNSDLHSHQRVHTGERPYVCDVCGKGFIYSSDLLIHQRVHTGEKPYKCAECGKGFSYSSGLLIHQRVHTGEKPYRCQECGKGFRCTSSLHKHQRVHTGKKPYTCDQCGKGFSYGSNLRTHQRLHTGEKPYTCCECGKGFRYGSGLLSHKRVHTGEKPYRCHVCGKGYSQSSHLQGHQRVHTGEKPYKCEECGKGFGRNSCLHVHQRVHTGEKPYTCGVCGKGFSYTSGLRNHQRVHLGENPYK
Domain KRAB, ZF, and degenerated ZF domains of KZFPs. :
...
# Domain name Pos
1 KRAB 34..108
2 dec2h2 291..315
3 C2h2 349..371
4 C2h2 377..399
5 C2h2 405..427
6 C2h2 433..455
7 C2h2 461..483
8 C2h2 489..511
9 C2h2 517..539
10 C2h2 545..566
11 C2h2 572..594
12 C2h2 600..622
13 C2h2 628..650
14 C2h2 656..678
15 C2h2 684..706
16 C2h2 712..734
17 C2h2 740..762
18 C2h2 768..790
19 C2h2 796..818
Gene Ontology Annotation The Gene Ontology (GO) describes knowledge of the biological domain based on three aspects: Molecular function, Biological process, and Cellular component. :
# Type TERM
1 Cellular Component nucleus
2 Molecular Function DNA-binding transcription activator activity, RNA polymerase II-specific
3 Molecular Function metal ion binding
4 Molecular Function RNA polymerase II cis-regulatory region sequence-specific DNA binding
5 Biological Process regulation of transcription by RNA polymerase II
Is there ChIP-seq data Is there any ChIP-seq data available for these KZFPs in the Cistrome database? :
Yes
Motif(meme-ChIP) DNA binding motifs of KZFPs obtained using meme-ChIP and mapped using pylogo. :
Forward:
...
Reverse:
...
Peak overlapping A ChIP-seq peak of KZFPs that intersects with a certain repeats sequences on the genome. :
# Repeats name Record number Significance Emergence time(Mya) Time correlation with KZFP
1 AluSc8 6 *** 74.0 Weakly correlated
2 L1P3 4 *** 74.0 Weakly correlated
3 LTR10A 4 **** 28.9 Weakly correlated
4 AluYj4 2 *** 0.0 Weakly correlated
5 AluYm1 2 ** 19.6 Weakly correlated
6 LTR10F 2 **** 28.9 Weakly correlated
7 AluJb 1 n.s 74.0 Weakly correlated
8 AluY 1 n.s 74.0 Weakly correlated
9 L1M3 1 n.s 99.0 Highly correlated
10 L1MB8 1 n.s 99.0 Highly correlated
11 L1PA2 1 n.s 15.2 Weakly correlated
12 L2c 1 n.s 99.0 Highly correlated
13 MER21B 1 * 99.0 Highly correlated
14 MLT1L 1 n.s 99.0 Highly correlated
15 SVA_D 1 n.s 15.2 Weakly correlated
16 SVA_F 1 * 0.0 Weakly correlated
Motif in Repeats The motif of KZFPs identified by the MEME-ChIP is present in repeats sequences. :
# Repeats name Record number Significance Emergence time(Mya) Time correlation with KZFP
1 AluSc8 1 n.s 74.0 Weakly correlated
2 MER21B 1 * 99.0 Highly correlated
3 AluYj4 1 ** 0.0 Weakly correlated
Motif in Repeats Consensus The motif of KZFPs identified by MEME-ChIP analysis can be utilized to locate the corresponding region within the consensus sequences of repeats. :
# Repeats name Emergence time(Mya) Time correlation with KZFP