ZRdb KZFP & Repeats
...

Human_ZNF214

  • Protein
    Zinc finger protein 214
  • Length
    606
  • Organism
    Homo sapiens (Human)
  • Time of emergence
    99.0 Mya
  • Time of Changing in binding specificity
    99.0 Mya
  • Uniprot_ID
    Q9UL59
  • NCBI_ID
    7761
Sequence:
MAVTFEDVTIIFTWEEWKFLDSSQKRLYREVMWENYTNVMSVENWNESYKSQEEKFRYLEYENFSYWQGWWNAGAQMYENQNYGETVQGTDSKDLTQQDRSQCQEWLILSTQVPGYGNYELTFESKSLRNLKYKNFMPWQSLETKTTQDYGREIYMSGSHGFQGGRYRLGISRKNLSMEKEQKLIVQHSYIPVEEALPQYVGVICQEDLLRDSMEEKYCGCNKCKGIYYWNSRCVFHKRNQPGENLCQCSICKACFSQRSDLYRHPRNHIGKKLYGCDEVDGNFHQSSGVHFHQRVHIGEVPYSCNACGKSFSQISSLHNHQRVHTEEKFYKIECDKDLSRNSLLHIHQRLHIGEKPFKCNQCGKSFNRSSVLHVHQRVHTGEKPYKCDECGKGFSQSSNLRIHQLVHTGEKSYKCEDCGKGFTQRSNLQIHQRVHTGEKPYKCDDCGKDFSHSSDLRIHQRVHTGEKPYTCPECGKGFSKSSKLHTHQRVHTGEKPYKCEECGKGFSQRSHLLIHQRVHTGEKPYKCHDCGKGFSHSSNLHIHQRVHTGEKPYQCAKCGKGFSHSSALRIHQRVHAGEKPYKCREYYKGFDHNSHLHNNHRRGNL
Domain KRAB, ZF, and degenerated ZF domains of KZFPs. :
...
# Domain name Pos
1 KRAB 3..83
2 dec2h2 275..297
3 C2h2 303..325
4 dec2h2 330..352
5 C2h2 358..380
6 C2h2 386..408
7 C2h2 414..436
8 C2h2 442..464
9 C2h2 470..492
10 C2h2 498..520
11 C2h2 526..548
12 C2h2 554..576
Gene Ontology Annotation The Gene Ontology (GO) describes knowledge of the biological domain based on three aspects: Molecular function, Biological process, and Cellular component. :
# Type TERM
1 Cellular Component nucleus
2 Molecular Function DNA-binding transcription factor activity, RNA polymerase II-specific
3 Molecular Function RNA polymerase II cis-regulatory region sequence-specific DNA binding
4 Molecular Function zinc ion binding
5 Biological Process regulation of transcription by RNA polymerase II
Is there ChIP-seq data Is there any ChIP-seq data available for these KZFPs in the Cistrome database? :
Yes
Motif(meme-ChIP) DNA binding motifs of KZFPs obtained using meme-ChIP and mapped using pylogo. :
Forward:
...
Reverse:
...
Peak overlapping A ChIP-seq peak of KZFPs that intersects with a certain repeats sequences on the genome. :
# Repeats name Record number Significance Emergence time(Mya) Time correlation with KZFP
1 MIRb 8 n.s 99.0 Highly correlated
2 L4_A_Mam 6 **** 99.0 Highly correlated
3 MIRc 5 * 99.0 Highly correlated
4 L1ME4c 4 **** 99.0 Highly correlated
5 L1M5 4 n.s 99.0 Highly correlated
6 L2b 3 n.s 99.0 Highly correlated
7 L1PA5 3 n.s 19.6 Weakly correlated
8 L2c 3 n.s 99.0 Highly correlated
9 MLT1H 3 ** 99.0 Highly correlated
10 L1ME4a 3 * 99.0 Highly correlated
11 LTR10A 3 **** 28.9 Weakly correlated
12 L1M4 2 n.s 99.0 Highly correlated
13 L2 2 n.s 99.0 Highly correlated
14 L3 2 n.s 99.0 Highly correlated
15 L1ME3Cz 2 * 99.0 Highly correlated
16 L1MC5 2 * 99.0 Highly correlated
17 MLT1L 2 * 99.0 Highly correlated
18 MIR 2 n.s 99.0 Highly correlated
19 HAL1ME 2 ** 99.0 Highly correlated
20 MLT1C 1 n.s 94.0 Weakly correlated
21 MamRTE1 1 * 99.0 Highly correlated
22 L2a 1 n.s 99.0 Highly correlated
23 MLT2B2 1 ** 99.0 Highly correlated
24 MLT1J1 1 * 99.0 Highly correlated
25 MLT1I 1 n.s 99.0 Highly correlated
26 MLT1F 1 * 99.0 Highly correlated
27 L4_B_Mam 1 ** 99.0 Highly correlated
28 L4_C_Mam 1 * 99.0 Highly correlated
29 MLT1E 1 ** 99.0 Highly correlated
30 MIR3 1 n.s 99.0 Highly correlated
31 LTR13 1 ** 19.6 Weakly correlated
32 MER89-int 1 ** 99.0 Highly correlated
33 MER39B 1 ** 74.0 Weakly correlated
34 MER4C 1 *** 74.0 Weakly correlated
35 MER65D 1 *** 87.0 Weakly correlated
36 L1PA4 1 n.s 19.6 Weakly correlated
37 MER50-int 1 ** 43.0 Weakly correlated
38 ERVL-E-int 1 n.s 99.0 Highly correlated
39 AluJo 1 n.s 74.0 Weakly correlated
40 AluJr 1 n.s 74.0 Weakly correlated
41 AluSc 1 n.s 74.0 Weakly correlated
42 AluSc8 1 n.s 74.0 Weakly correlated
43 AluSp 1 n.s 74.0 Weakly correlated
44 AluSq2 1 n.s 74.0 Weakly correlated
45 AluSx1 1 n.s 74.0 Weakly correlated
46 AluSz 1 n.s 74.0 Weakly correlated
47 AluYh9 1 **** 15.2 Weakly correlated
48 AluYj4 1 ** 0.0 Weakly correlated
49 AluYm1 1 * 19.6 Weakly correlated
50 CR1_Mam 1 ** 99.0 Highly correlated
51 ERVL-B4-int 1 n.s 99.0 Highly correlated
52 L1PA8A 1 n.s 74.0 Weakly correlated
53 FRAM 1 * 74.0 Weakly correlated
54 HERVL-int 1 n.s 74.0 Weakly correlated
55 L1MA9 1 n.s 99.0 Highly correlated
56 L1MB1 1 n.s 99.0 Highly correlated
57 L1ME3 1 n.s 99.0 Highly correlated
58 L1ME3F 1 * 99.0 Highly correlated
59 L1MEc 1 n.s 99.0 Highly correlated
60 L1P1 1 n.s 19.6 Weakly correlated
61 L1PA10 1 n.s 74.0 Weakly correlated
62 L1PA2 1 n.s 15.2 Weakly correlated
63 AluJb 1 n.s 74.0 Weakly correlated
64 L1PA7 1 n.s 74.0 Weakly correlated
Motif in Repeats The motif of KZFPs identified by the MEME-ChIP is present in repeats sequences. :
# Repeats name Record number Significance Emergence time(Mya) Time correlation with KZFP
1 L2c 1 n.s 99.0 Highly correlated
2 AluYh9 1 **** 15.2 Weakly correlated
3 L2 1 n.s 99.0 Highly correlated
4 MLT1E 1 ** 99.0 Highly correlated
Motif in Repeats Consensus The motif of KZFPs identified by MEME-ChIP analysis can be utilized to locate the corresponding region within the consensus sequences of repeats. :
# Repeats name Emergence time(Mya) Time correlation with KZFP