ZRdb KZFP & Repeats
...

Human_ZNF213

  • Protein
    Zinc finger protein 213
  • Length
    459
  • Organism
    Homo sapiens (Human)
  • Time of emergence
    180.0 Mya
  • Time of Changing in binding specificity
    180.0 Mya
  • Uniprot_ID
    O14771
  • NCBI_ID
    7760
Sequence:
MAAPLEAQDQAPGEGEGLLIVKVEDSSWEQESAQHEDGRDSEACRQRFRQFCYGDVHGPHEAFSQLWELCCRWLRPELRTKEQILELLVLEQFLTVLPGEIQGWVREQHPGSGEEAVALVEDLQKQPVKAWRQDVPSEEAEPEAAGRGSQATGPPPTVGARRRPSVPQEQHSHSAQPPALLKEGRPGETTDTCFVSGVHGPVALGDIPFYFSREEWGTLDPAQRDLFWDIKRENSRNTTLGFGLKGQSEKSLLQEMVPVVPGQTGSDVTVSWSPEEAEAWESENRPRAALGPVVGARRGRPPTRRRQFRDLAAEKPHSCGQCGKRFRWGSDLARHQRTHTGEKPHKCPECDKSFRSSSDLVRHQGVHTGEKPFSCSECGKSFSRSAYLADHQRIHTGEKPFGCSDCGKSFSLRSYLLDHRRVHTGERPFGCGECDKSFKQRAHLIAHQSLHAKMAQPVG
Domain KRAB, ZF, and degenerated ZF domains of KZFPs. :
...
# Domain name Pos
1 scan 45..126
2 KRAB 202..292
3 C2h2 317..339
4 C2h2 345..367
5 C2h2 373..395
6 C2h2 401..423
7 C2h2 429..451
Gene Ontology Annotation The Gene Ontology (GO) describes knowledge of the biological domain based on three aspects: Molecular function, Biological process, and Cellular component. :
# Type TERM
1 Cellular Component nucleus
2 Molecular Function DNA-binding transcription factor activity, RNA polymerase II-specific
3 Molecular Function metal ion binding
4 Molecular Function RNA polymerase II cis-regulatory region sequence-specific DNA binding
5 Biological Process regulation of transcription by RNA polymerase II
Is there ChIP-seq data Is there any ChIP-seq data available for these KZFPs in the Cistrome database? :
Yes
Motif(meme-ChIP) DNA binding motifs of KZFPs obtained using meme-ChIP and mapped using pylogo. :
Forward:
...
Reverse:
...
Peak overlapping A ChIP-seq peak of KZFPs that intersects with a certain repeats sequences on the genome. :
# Repeats name Record number Significance Emergence time(Mya) Time correlation with KZFP
1 AluYj4 8 **** 0.0 Weakly correlated
2 AluSc8 6 ** 74.0 Weakly correlated
3 FRAM 4 **** 74.0 Weakly correlated
4 L1P3 3 * 74.0 Weakly correlated
5 AluJo 2 n.s 74.0 Weakly correlated
6 HUERS-P3b-int 2 *** 43.0 Weakly correlated
7 AluY 2 n.s 74.0 Weakly correlated
8 AluYi6 1 *** 15.2 Weakly correlated
9 AluYm1 1 n.s 19.6 Weakly correlated
10 AluSq 1 n.s 74.0 Weakly correlated
11 L1MB8 1 n.s 99.0 Weakly correlated
12 AluJb 1 n.s 74.0 Weakly correlated
13 L1P4 1 n.s 74.0 Weakly correlated
14 L1PA4 1 n.s 19.6 Weakly correlated
15 LTR13 1 ** 19.6 Weakly correlated
16 MER21B 1 n.s 99.0 Weakly correlated
17 SVA_C 1 ** 15.2 Weakly correlated
Motif in Repeats The motif of KZFPs identified by the MEME-ChIP is present in repeats sequences. :
# Repeats name Record number Significance Emergence time(Mya) Time correlation with KZFP
1 HUERS-P3b-int 2 *** 43.0 Weakly correlated
2 AluYa8 1 **** 15.2 Weakly correlated
3 AluSq 1 n.s 74.0 Weakly correlated
4 AluSc8 1 n.s 74.0 Weakly correlated
5 AluJo 1 n.s 74.0 Weakly correlated
6 AluYj4 1 * 0.0 Weakly correlated
7 FRAM 1 * 74.0 Weakly correlated
8 AluJb 1 n.s 74.0 Weakly correlated
9 AluY 1 n.s 74.0 Weakly correlated
Motif in Repeats Consensus The motif of KZFPs identified by MEME-ChIP analysis can be utilized to locate the corresponding region within the consensus sequences of repeats. :
# Repeats name Emergence time(Mya) Time correlation with KZFP