ZRdb KZFP & Repeats
...

Human_ZNF212

  • Protein
    Zinc finger protein 212
  • Length
    495
  • Organism
    Homo sapiens (Human)
  • Time of emergence
    160.0 Mya
  • Time of Changing in binding specificity
    160.0 Mya
  • Uniprot_ID
    Q9UDV6
  • NCBI_ID
    7988
Sequence:
MAESAPARHRRKRRSTPLTSSTLPSQATEKSSYFQTTEISLWTVVAAIQAVEKKMESQAARLQSLEGRTGTAEKKLADCEKMAVEFGNQLEGKWAVLGTLLQEYGLLQRRLENVENLLRNRNFWILRLPPGSKGEAPKVSRSLENDGVCFTEQEWENLEDWQKELYRNVMESNYETLVSLKVLGQTEGEAELGTEMLGDLEEEGPGGAHPAGGVMIKQELQYTQEGPADLPGEFSCIAEEQAFLSPEQTELWGGQGSSVLLETGPGDSTLEEPVGSRVPSSSRTVGCPKQKSHRQVQLDQECGQGLKLKKDTSRPYECSECEITFRYKQQLATHLRSHSGWGSCTPEEPEESLRPRPRLKPQTKKAKLHQCDVCLRSFSCKVSLVTHQRCHLQEGPSAGQHVQERFSPNSLVALPGHIPWRKSRSSLICGYCGKSFSHPSDLVRHQRIHTGERPYSCTECEKSFVQKQHLLQHQKIHQRERGGLALEPGRPNGLL
Domain KRAB, ZF, and degenerated ZF domains of KZFPs. :
...
# Domain name Pos
1 KRAB 141..219
2 C2h2 316..338
3 C2h2 369..391
4 C2h2 427..449
5 C2h2 455..477
Gene Ontology Annotation The Gene Ontology (GO) describes knowledge of the biological domain based on three aspects: Molecular function, Biological process, and Cellular component. :
# Type TERM
1 Cellular Component nucleoplasm
2 Molecular Function DNA-binding transcription factor activity
3 Molecular Function identical protein binding
4 Molecular Function RNA polymerase II cis-regulatory region sequence-specific DNA binding
5 Molecular Function zinc ion binding
6 Biological Process regulation of DNA-templated transcription
7 Biological Process regulation of transcription by RNA polymerase II
Is there ChIP-seq data Is there any ChIP-seq data available for these KZFPs in the Cistrome database? :
Yes
Motif(meme-ChIP) DNA binding motifs of KZFPs obtained using meme-ChIP and mapped using pylogo. :
Forward:
...
Reverse:
...
Peak overlapping A ChIP-seq peak of KZFPs that intersects with a certain repeats sequences on the genome. :
# Repeats name Record number Significance Emergence time(Mya) Time correlation with KZFP
1 HERV17-int 3 **** 28.9 Weakly correlated
2 HERVIP10FH-int 3 **** 28.9 Weakly correlated
3 LTR10A 3 **** 28.9 Weakly correlated
4 AluJb 3 n.s 74.0 Weakly correlated
5 AluY 2 n.s 74.0 Weakly correlated
6 HAL1 2 n.s 99.0 Weakly correlated
7 L1PA5 2 n.s 19.6 Weakly correlated
8 L1P1 2 ** 19.6 Weakly correlated
9 L1MA8 1 n.s 87.0 Weakly correlated
10 MLT1K 1 n.s 99.0 Weakly correlated
11 MLT1F1 1 ** 99.0 Weakly correlated
12 MER50 1 ** 43.0 Weakly correlated
13 MER39B 1 ** 74.0 Weakly correlated
14 L2a 1 n.s 99.0 Weakly correlated
15 L1ME4c 1 * 99.0 Weakly correlated
16 L1ME4b 1 n.s 99.0 Weakly correlated
17 L1ME4a 1 n.s 99.0 Weakly correlated
18 L1M4 1 n.s 99.0 Weakly correlated
19 L1M1 1 n.s 74.0 Weakly correlated
20 HERVS71-int 1 ** 28.9 Weakly correlated
21 AluSp 1 n.s 74.0 Weakly correlated
22 AluSc8 1 n.s 74.0 Weakly correlated
23 AluSc5 1 * 74.0 Weakly correlated
24 AluJo 1 n.s 74.0 Weakly correlated
Motif in Repeats The motif of KZFPs identified by the MEME-ChIP is present in repeats sequences. :
# Repeats name Record number Significance Emergence time(Mya) Time correlation with KZFP
1 HERVIP10FH-int 3 **** 28.9 Weakly correlated
2 HERV17-int 3 **** 28.9 Weakly correlated
3 HAL1 2 n.s 99.0 Weakly correlated
4 HERVS71-int 1 ** 28.9 Weakly correlated
5 AluJo 1 n.s 74.0 Weakly correlated
6 L1M1 1 n.s 74.0 Weakly correlated
7 L2a 1 n.s 99.0 Weakly correlated
8 AluSc5 1 * 74.0 Weakly correlated
9 AluY 1 n.s 74.0 Weakly correlated
10 MER50 1 ** 43.0 Weakly correlated
11 MLT1K 1 n.s 99.0 Weakly correlated
12 L1P1 1 * 19.6 Weakly correlated
13 MER39B 1 ** 74.0 Weakly correlated
Motif in Repeats Consensus The motif of KZFPs identified by MEME-ChIP analysis can be utilized to locate the corresponding region within the consensus sequences of repeats. :
# Repeats name Emergence time(Mya) Time correlation with KZFP