ZRdb KZFP & Repeats
...

Human_ZNF205

  • Protein
    Zinc finger protein 205
  • Length
    554
  • Organism
    Homo sapiens (Human)
  • Time of emergence
    180.0 Mya
  • Time of Changing in binding specificity
    180.0 Mya
  • Uniprot_ID
    O95201
  • NCBI_ID
    7755
Sequence:
MSADGGGIQDTQDKETPPEVPDRGHPHQEMPSKLGEAVPSGDTQESLHIKMEPEEPHSEGASQEDGAQGAWGWAPLSHGSKEKALFLPGGALPSPRIPVLSREGRTRDRQMAAALLTAWSQMPVTFEDVALYLSREEWGRLDHTQQNFYRDVLQKKNGLSLGFPFSRPFWAPQAHGKGEASGSSRQAGDEKEWRGACTGAVEVGQRVQTSSVAALGNVKPFRTRAGRVQWGVPQCAQEAACGRSSGPAKDSGQPAEPDRTPDAAPPDPSPTEPQEYRVPEKPNEEEKGAPESGEEGLAPDSEVGRKSYRCEQCGKGFSWHSHLVTHRRTHTGEKPYACTDCGKRFGRSSHLIQHQIIHTGEKPYTCPACRKSFSHHSTLIQHQRIHTGEKPYVCDRCAKRFTRRSDLVTHQGTHTGAKPHKCPICAKCFTQSSALVTHQRTHTGVKPYPCPECGKCFSQRSNLIAHNRTHTGEKPYHCLDCGKSFSHSSHLTAHQRTHRGVRPYACPLCGKSFSRRSNLHRHEKIHTTGPKALAMLMLGAAAAGALATPPPAPT
Domain KRAB, ZF, and degenerated ZF domains of KZFPs. :
...
# Domain name Pos
1 KRAB 124..193
2 C2h2 308..330
3 C2h2 336..358
4 C2h2 364..386
5 C2h2 392..414
6 C2h2 420..442
7 C2h2 448..470
8 C2h2 476..498
9 C2h2 504..526
Gene Ontology Annotation The Gene Ontology (GO) describes knowledge of the biological domain based on three aspects: Molecular function, Biological process, and Cellular component. :
# Type TERM
1 Cellular Component mitochondrion
2 Cellular Component nucleus
3 Molecular Function DNA-binding transcription factor activity, RNA polymerase II-specific
4 Molecular Function DNA-binding transcription repressor activity, RNA polymerase II-specific
5 Molecular Function RNA polymerase II cis-regulatory region sequence-specific DNA binding
6 Molecular Function zinc ion binding
7 Biological Process negative regulation of transcription by RNA polymerase II
8 Biological Process positive regulation of hydrogen peroxide biosynthetic process
9 Biological Process positive regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway
10 Biological Process regulation of DNA-templated transcription
11 Biological Process regulation of transcription by RNA polymerase II
Is there ChIP-seq data Is there any ChIP-seq data available for these KZFPs in the Cistrome database? :
Yes
Motif(meme-ChIP) DNA binding motifs of KZFPs obtained using meme-ChIP and mapped using pylogo. :
Forward:
...
Reverse:
...
Peak overlapping A ChIP-seq peak of KZFPs that intersects with a certain repeats sequences on the genome. :
# Repeats name Record number Significance Emergence time(Mya) Time correlation with KZFP
1 L1P3 4 **** 74.0 Weakly correlated
2 AluSp 4 * 74.0 Weakly correlated
3 AluSx 3 n.s 74.0 Weakly correlated
4 LTR10A 3 **** 28.9 Weakly correlated
5 AluSc8 2 * 74.0 Weakly correlated
6 AluSg 2 n.s 74.0 Weakly correlated
7 AluY 2 n.s 74.0 Weakly correlated
8 L2a 2 n.s 99.0 Weakly correlated
9 LTR13 1 ** 19.6 Weakly correlated
10 L1P4 1 * 74.0 Weakly correlated
11 L1PA15 1 n.s 74.0 Weakly correlated
12 L1PA2 1 n.s 15.2 Weakly correlated
13 L1PA5 1 n.s 19.6 Weakly correlated
14 L2 1 n.s 99.0 Weakly correlated
15 L3 1 n.s 99.0 Weakly correlated
16 L1ME1 1 n.s 99.0 Weakly correlated
17 LTR16A 1 ** 99.0 Weakly correlated
18 MIR 1 n.s 99.0 Weakly correlated
19 MSTA 1 n.s 43.0 Weakly correlated
20 L1P1 1 * 19.6 Weakly correlated
21 L1ME4b 1 n.s 99.0 Weakly correlated
22 AluJr 1 n.s 74.0 Weakly correlated
23 L1MA9 1 n.s 99.0 Weakly correlated
24 L1MA8 1 n.s 87.0 Weakly correlated
25 L1MA4A 1 n.s 87.0 Weakly correlated
26 Harlequin-int 1 ** 74.0 Weakly correlated
27 FRAM 1 ** 74.0 Weakly correlated
28 AluYm1 1 * 19.6 Weakly correlated
29 AluSz 1 n.s 74.0 Weakly correlated
30 AluSq2 1 n.s 74.0 Weakly correlated
31 AluSc 1 n.s 74.0 Weakly correlated
Motif in Repeats The motif of KZFPs identified by the MEME-ChIP is present in repeats sequences. :
# Repeats name Record number Significance Emergence time(Mya) Time correlation with KZFP
1 AluY 1 n.s 74.0 Weakly correlated
Motif in Repeats Consensus The motif of KZFPs identified by MEME-ChIP analysis can be utilized to locate the corresponding region within the consensus sequences of repeats. :
# Repeats name Emergence time(Mya) Time correlation with KZFP