ZRdb KZFP & Repeats
...

Human_ZNF195

  • Protein
    Zinc finger protein 195
  • Length
    629
  • Organism
    Homo sapiens (Human)
  • Time of emergence
    43.0 Mya
  • Time of Changing in binding specificity
    28.9 Mya
  • Uniprot_ID
    O14628
  • NCBI_ID
    7748
Sequence:
MTLLTFRDVAIEFSLEEWKCLDLAQQNLYRDVMLENYRNLFSVGLTVCKPGLITCLEQRKEPWNVKRQEAADGHPEMGFHHATQACLELLGSSDLPASASQSAGITGVNHRAQPGLNVSVDKFTALCSPGVLQTVKWFLEFRCIFSLAMSSHFTQDLLPEQGIQDAFPKRILRGYGNCGLDNLYLRKDWESLDECKLQKDYNGLNQCSSTTHSKIFQYNKYVKIFDNFSNLHRRNISNTGEKPFKCQECGKSFQMLSFLTEHQKIHTGKKFQKCGECGKTFIQCSHFTEPENIDTGEKPYKCQECNNVIKTCSVLTKNRIYAGGEHYRCEEFGKVFNQCSHLTEHEHGTEEKPCKYEECSSVFISCSSLSNQQMILAGEKLSKCETWYKGFNHSPNPSKHQRNEIGGKPFKCEECDSIFKWFSDLTKHKRIHTGEKPYKCDECGKAYTQSSHLSEHRRIHTGEKPYQCEECGKVFRTCSSLSNHKRTHSEEKPYTCEECGNIFKQLSDLTKHKKTHTGEKPYKCDECGKNFTQSSNLIVHKRIHTGEKPYKCEECGRVFMWFSDITKHKKTHTGEKPYKCDECGKNFTQSSNLIVHKRIHTGEKPYKCEKCGKAFTQFSHLTVHESIHT
Domain KRAB, ZF, and degenerated ZF domains of KZFPs. :
...
# Domain name Pos
1 KRAB 4..75
2 C2h2 244..266
3 dec2h2 272..294
4 C2h2 410..432
5 C2h2 438..460
6 C2h2 466..488
7 C2h2 494..516
8 C2h2 522..544
9 C2h2 550..572
10 C2h2 578..600
11 C2h2 606..628
Gene Ontology Annotation The Gene Ontology (GO) describes knowledge of the biological domain based on three aspects: Molecular function, Biological process, and Cellular component. :
# Type TERM
1 Cellular Component nucleus
2 Molecular Function DNA-binding transcription factor activity, RNA polymerase II-specific
3 Molecular Function RNA polymerase II cis-regulatory region sequence-specific DNA binding
4 Molecular Function zinc ion binding
5 Biological Process regulation of DNA-templated transcription
Is there ChIP-seq data Is there any ChIP-seq data available for these KZFPs in the Cistrome database? :
Yes
Motif(meme-ChIP) DNA binding motifs of KZFPs obtained using meme-ChIP and mapped using pylogo. :
Forward:
...
Reverse:
...
Peak overlapping A ChIP-seq peak of KZFPs that intersects with a certain repeats sequences on the genome. :
# Repeats name Record number Significance Emergence time(Mya) Time correlation with KZFP
1 LTR8 8 **** 43.0 Moderately correlated
2 L1P3 7 **** 74.0 Weakly correlated
3 AluSc8 6 *** 74.0 Weakly correlated
4 AluY 5 n.s 74.0 Weakly correlated
5 AluYj4 4 **** 0.0 Weakly correlated
6 FRAM 4 **** 74.0 Weakly correlated
7 LTR10A 4 **** 28.9 Highly correlated
8 LTR10F 3 **** 28.9 Highly correlated
9 MLT1L 1 n.s 99.0 Weakly correlated
10 AluJb 1 n.s 74.0 Weakly correlated
11 MIRb 1 n.s 99.0 Weakly correlated
12 LTR10B1 1 **** 28.9 Highly correlated
13 L1PA8A 1 n.s 74.0 Weakly correlated
14 L1PA5 1 n.s 19.6 Weakly correlated
15 L1P4 1 n.s 74.0 Weakly correlated
16 L1MC4 1 n.s 99.0 Weakly correlated
17 L1MB8 1 n.s 99.0 Weakly correlated
18 L1M3 1 n.s 99.0 Weakly correlated
19 L1HS 1 n.s 8.6 Weakly correlated
20 HERV17-int 1 * 28.9 Highly correlated
21 AluYm1 1 * 19.6 Weakly correlated
22 AluYi6 1 *** 15.2 Weakly correlated
23 AluSp 1 n.s 74.0 Weakly correlated
Motif in Repeats The motif of KZFPs identified by the MEME-ChIP is present in repeats sequences. :
# Repeats name Record number Significance Emergence time(Mya) Time correlation with KZFP
1 FRAM 3 *** 74.0 Weakly correlated
2 AluYj4 2 *** 0.0 Weakly correlated
3 AluY 1 n.s 74.0 Weakly correlated
4 AluSc8 1 n.s 74.0 Weakly correlated
Motif in Repeats Consensus The motif of KZFPs identified by MEME-ChIP analysis can be utilized to locate the corresponding region within the consensus sequences of repeats. :
# Repeats name Emergence time(Mya) Time correlation with KZFP