ZRdb KZFP & Repeats
...

Human_ZNF19

  • Protein
    Zinc finger protein 19
  • Length
    458
  • Organism
    Homo sapiens (Human)
  • Time of emergence
    99.0 Mya
  • Time of Changing in binding specificity
    99.0 Mya
  • Uniprot_ID
    P17023
  • NCBI_ID
    7567
Sequence:
MAAMPLKAQYQEMVTFEDVAVHFTKTEWTGLSPAQRALYRSVMLENFGNLTALGYPVPKPALISLLERGDMAWGLEAQDDPPAERTKNVCKDVETNIDSESTLIQGISEERDGMMSHGQLKSVPQRTDFPETRNVEKHQDIPTVKNIQGKVPRIPCARKPFICEECGKSFSYFSYYARHQRIHTGEKPFECSECGKAFNGNSSLIRHQRIHTGERPYQCEECGRAFNDNANLIRHQRIHSGDRPYYCTECGNSFTSSSEFVIHQRIHTGEKPYECNECGKAFVGNSPLLRHQKIHTGEKPYECNECGKSFGRTSHLSQHQRIHTGEKPYSCKVCGQAFNFHTKLTRHQRIHSEEKPFDCVDCGKAFSAQEQLKRHLRIHTQESSYVCDECGKALTSKRNLHQHQRIHTGEKPYECSKYEKAFGTSSQLGHLEHVYSGEKPVLDICRFGLPEFFTPFYW
Domain KRAB, ZF, and degenerated ZF domains of KZFPs. :
...
# Domain name Pos
1 KRAB 14..85
2 C2h2 161..183
3 C2h2 189..211
4 C2h2 217..239
5 C2h2 245..267
6 C2h2 273..295
7 C2h2 301..323
8 C2h2 329..351
9 C2h2 357..379
10 C2h2 385..407
11 C2h2 413..433
Gene Ontology Annotation The Gene Ontology (GO) describes knowledge of the biological domain based on three aspects: Molecular function, Biological process, and Cellular component. :
# Type TERM
1 Cellular Component nucleus
2 Molecular Function DNA-binding transcription factor activity, RNA polymerase II-specific
3 Molecular Function DNA-binding transcription repressor activity, RNA polymerase II-specific
4 Molecular Function metal ion binding
5 Molecular Function RNA polymerase II transcription regulatory region sequence-specific DNA binding
6 Biological Process negative regulation of transcription by RNA polymerase II
7 Biological Process regulation of transcription by RNA polymerase II
Is there ChIP-seq data Is there any ChIP-seq data available for these KZFPs in the Cistrome database? :
Yes
Motif(meme-ChIP) DNA binding motifs of KZFPs obtained using meme-ChIP and mapped using pylogo. :
Forward:
...
Reverse:
...
Peak overlapping A ChIP-seq peak of KZFPs that intersects with a certain repeats sequences on the genome. :
# Repeats name Record number Significance Emergence time(Mya) Time correlation with KZFP
1 L2a 4 n.s 99.0 Highly correlated
2 MIR 4 n.s 99.0 Highly correlated
3 AluYj4 4 **** 0.0 Weakly correlated
4 LTR10A 3 **** 28.9 Weakly correlated
5 L2c 3 n.s 99.0 Highly correlated
6 L2b 3 n.s 99.0 Highly correlated
7 ERVL-E-int 3 * 99.0 Highly correlated
8 MLT1B 3 * 99.0 Highly correlated
9 AluSx 3 n.s 74.0 Weakly correlated
10 L1PA5 3 n.s 19.6 Weakly correlated
11 AluJb 3 n.s 74.0 Weakly correlated
12 L2 2 n.s 99.0 Highly correlated
13 MIR3 2 n.s 99.0 Highly correlated
14 L1PA2 2 n.s 15.2 Weakly correlated
15 AluSc8 2 n.s 74.0 Weakly correlated
16 L1ME5 2 ** 99.0 Highly correlated
17 MLT2D 1 * 99.0 Highly correlated
18 L3b 1 n.s 99.0 Highly correlated
19 L1PB1 1 n.s 74.0 Weakly correlated
20 LTR13 1 ** 19.6 Weakly correlated
21 LTR16A 1 * 99.0 Highly correlated
22 LTR50 1 * 99.0 Highly correlated
23 LTR66 1 *** 43.0 Weakly correlated
24 LTR71B 1 *** 43.0 Weakly correlated
25 LTR9B 1 ** 43.0 Weakly correlated
26 MER57-int 1 * 87.0 Weakly correlated
27 MER90a 1 ** 99.0 Highly correlated
28 MIRb 1 n.s 99.0 Highly correlated
29 MLT1H 1 n.s 99.0 Highly correlated
30 MLT2A2 1 n.s 74.0 Weakly correlated
31 HERV9N-int 1 ** 19.6 Weakly correlated
32 AluJr 1 n.s 74.0 Weakly correlated
33 AluSc 1 n.s 74.0 Weakly correlated
34 AluSq2 1 n.s 74.0 Weakly correlated
35 AluSx3 1 n.s 74.0 Weakly correlated
36 AluY 1 n.s 74.0 Weakly correlated
37 AluYh9 1 **** 15.2 Weakly correlated
38 ERVL-B4-int 1 n.s 99.0 Highly correlated
39 FLAM_C 1 n.s 74.0 Weakly correlated
40 HAL1 1 n.s 99.0 Highly correlated
41 HAL1M8 1 * 99.0 Highly correlated
42 L1PA6 1 n.s 28.9 Weakly correlated
43 L1M4b 1 n.s 99.0 Highly correlated
44 L1MA8 1 n.s 87.0 Weakly correlated
45 L1MB3 1 n.s 99.0 Highly correlated
46 L1MC4 1 n.s 99.0 Highly correlated
47 L1MD1 1 n.s 99.0 Highly correlated
48 L1ME3B 1 n.s 99.0 Highly correlated
49 L1MEd 1 n.s 99.0 Highly correlated
50 L1P1 1 n.s 19.6 Weakly correlated
51 L1PA16 1 n.s 74.0 Weakly correlated
52 L1PA4 1 n.s 19.6 Weakly correlated
Motif in Repeats The motif of KZFPs identified by the MEME-ChIP is present in repeats sequences. :
# Repeats name Record number Significance Emergence time(Mya) Time correlation with KZFP
1 AluYh9 1 **** 15.2 Weakly correlated
2 AluYj4 1 * 0.0 Weakly correlated
Motif in Repeats Consensus The motif of KZFPs identified by MEME-ChIP analysis can be utilized to locate the corresponding region within the consensus sequences of repeats. :
# Repeats name Emergence time(Mya) Time correlation with KZFP