ZRdb KZFP & Repeats
...

Human_ZFP1

  • Protein
    Zinc finger protein 1 homolog
  • Length
    407
  • Organism
    Homo sapiens (Human)
  • Time of emergence
    99.0 Mya
  • Time of Changing in binding specificity
    99.0 Mya
  • Uniprot_ID
    Q6P2D0
  • NCBI_ID
    162239
Sequence:
MNKSQGSVSFTDVTVDFTQEEWEQLDPSQRILYMDVMLENYSNLLSVEVWKADDQMERDHRNPDEQARQFLILKNQTPIEERGDLFGKALNLNTDFVSLRQVPYKYDLYEKTLKYNSDLLNSNRSYAGKQTDECNEFGKALLYLKQEKTHSGVEYSEYNKSGKALSHKAAIFKHQKIKNLVQPFICTYCDKAFSFKSLLISHKRIHTGEKPYECNVCKKTFSHKANLIKHQRIHTGEKPFECPECGKAFTHQSNLIVHQRAHMEKKPYECSECGKTFAQKFELTTHQRIHTGERPYECNECAKTFFKKSNLIIHQKIHTGEKRYECSECGKSFIQNSQLIIHMRTHTGEKPYECTECGKTFSQRSTLRLHLRIHTGEKPYECSECGKAFSRKSRLSVHQRVHIGEKP
Domain KRAB, ZF, and degenerated ZF domains of KZFPs. :
...
# Domain name Pos
1 KRAB 8..83
2 C2h2 184..206
3 C2h2 212..234
4 C2h2 240..262
5 C2h2 268..290
6 C2h2 296..318
7 C2h2 324..346
8 C2h2 352..374
9 C2h2 380..402
Gene Ontology Annotation The Gene Ontology (GO) describes knowledge of the biological domain based on three aspects: Molecular function, Biological process, and Cellular component. :
# Type TERM
1 Cellular Component nucleus
2 Molecular Function DNA-binding transcription factor activity, RNA polymerase II-specific
3 Molecular Function metal ion binding
4 Molecular Function RNA polymerase II cis-regulatory region sequence-specific DNA binding
5 Molecular Function sequence-specific double-stranded DNA binding
6 Biological Process regulation of transcription by RNA polymerase II
Is there ChIP-seq data Is there any ChIP-seq data available for these KZFPs in the Cistrome database? :
Yes
Motif(meme-ChIP) DNA binding motifs of KZFPs obtained using meme-ChIP and mapped using pylogo. :
Forward:
...
Reverse:
...
Peak overlapping A ChIP-seq peak of KZFPs that intersects with a certain repeats sequences on the genome. :
# Repeats name Record number Significance Emergence time(Mya) Time correlation with KZFP
1 HAL1 9 **** 99.0 Highly correlated
2 L1PA7 8 *** 74.0 Weakly correlated
3 AluJb 4 n.s 74.0 Weakly correlated
4 L1MEc 4 ** 99.0 Highly correlated
5 LTR10A 3 **** 28.9 Weakly correlated
6 AluSg 2 n.s 74.0 Weakly correlated
7 L1PA4 2 n.s 19.6 Weakly correlated
8 L1PA5 2 n.s 19.6 Weakly correlated
9 L1P2 2 ** 28.9 Weakly correlated
10 L1M4b 2 ** 99.0 Highly correlated
11 L1M4 2 n.s 99.0 Highly correlated
12 AluSx1 2 n.s 74.0 Weakly correlated
13 LTR47B 1 **** 74.0 Weakly correlated
14 LTR13 1 *** 19.6 Weakly correlated
15 LTR85b 1 *** 99.0 Highly correlated
16 MER50 1 ** 43.0 Weakly correlated
17 L2c 1 n.s 99.0 Highly correlated
18 L2b 1 n.s 99.0 Highly correlated
19 MER66B 1 *** 43.0 Weakly correlated
20 L2a 1 n.s 99.0 Highly correlated
21 MIR 1 n.s 99.0 Highly correlated
22 L1PA6 1 n.s 28.9 Weakly correlated
23 MLT1J2 1 ** 99.0 Highly correlated
24 L1PA3 1 n.s 19.6 Weakly correlated
25 L1PA17 1 * 74.0 Weakly correlated
26 L1PA10 1 n.s 74.0 Weakly correlated
27 L1P3 1 * 74.0 Weakly correlated
28 L1P1 1 * 19.6 Weakly correlated
29 L1MEf 1 n.s 99.0 Highly correlated
30 L1MEd 1 n.s 99.0 Highly correlated
31 L1MC4 1 n.s 99.0 Highly correlated
32 L1MB7 1 n.s 99.0 Highly correlated
33 L1M2c 1 *** 87.0 Weakly correlated
34 L1M1 1 n.s 74.0 Weakly correlated
35 HAL1b 1 ** 99.0 Highly correlated
36 FLAM_A 1 * 74.0 Weakly correlated
37 AluSg7 1 * 74.0 Weakly correlated
Motif in Repeats The motif of KZFPs identified by the MEME-ChIP is present in repeats sequences. :
# Repeats name Record number Significance Emergence time(Mya) Time correlation with KZFP
1 HAL1 8 **** 99.0 Highly correlated
2 L1PA7 7 ** 74.0 Weakly correlated
3 L1M4b 2 ** 99.0 Highly correlated
4 L1MEc 2 n.s 99.0 Highly correlated
5 L1P2 2 ** 28.9 Weakly correlated
6 L2c 1 n.s 99.0 Highly correlated
7 L1PA6 1 n.s 28.9 Weakly correlated
8 L1PA4 1 n.s 19.6 Weakly correlated
9 L1PA3 1 n.s 19.6 Weakly correlated
10 L1PA17 1 * 74.0 Weakly correlated
11 L1PA10 1 n.s 74.0 Weakly correlated
12 L1P3 1 * 74.0 Weakly correlated
13 L1MEf 1 n.s 99.0 Highly correlated
14 L1MC4 1 n.s 99.0 Highly correlated
15 L1MB7 1 n.s 99.0 Highly correlated
16 L1M4 1 n.s 99.0 Highly correlated
17 L1M2c 1 *** 87.0 Weakly correlated
18 L1M1 1 n.s 74.0 Weakly correlated
Motif in Repeats Consensus The motif of KZFPs identified by MEME-ChIP analysis can be utilized to locate the corresponding region within the consensus sequences of repeats. :
# Repeats name Emergence time(Mya) Time correlation with KZFP
1 L1PA7 74.0 Weakly correlated